SecReT6
Protein ID: 15596859
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1662
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1810751..1813384 [+]
ProductClpA/B-type protease
NoteTssH
UniProt IDQ9I363
KEGG IDpae:PA1662
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 6.10E-44, Aligned region: 208..286
AAA_2 [PF07724], Evalue: 6.10E-44, Aligned region: 611..776
AAA [PF00004], Evalue: 7.00E-20, Aligned region: 210..341
AAA [PF00004], Evalue: 7.00E-20, Aligned region: 616..739
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 210..232
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 615..734
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 441..457
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 735..765
ClpB_D2-small [PF10431], Evalue: 6.80E-12, Aligned region: 787..856
AAA_22 [PF13401], Evalue: 2.80E-09, Aligned region: 209..296
AAA_22 [PF13401], Evalue: 2.80E-09, Aligned region: 614..720
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 11..97
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 188..232
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 254..288
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 586..651
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 680..709
AAA_16 [PF13191], Evalue: 3.00E-08, Aligned region: 763..842
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 210..264
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 458..458
AAA_17 [PF13207], Evalue: 1.20E-06, Aligned region: 614..650
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 210..237
NACHT [PF05729], Evalue: 1.70E-05, Aligned region: 615..654
Sigma54_activat [PF00158], Evalue: 2.70E-05, Aligned region: 205..228
Sigma54_activat [PF00158], Evalue: 2.70E-05, Aligned region: 615..734
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 30..75
Clp_N [PF02861], Evalue: 2.80E-05, Aligned region: 104..124
AAA_19 [PF13245], Evalue: 5.70E-05, Aligned region: 207..235
AAA_19 [PF13245], Evalue: 5.70E-05, Aligned region: 355..386
AAA_19 [PF13245], Evalue: 5.70E-05, Aligned region: 613..637
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 204..229
IstB_IS21 [PF01695], Evalue: 0.0001, Aligned region: 615..633
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 210..234
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 266..306
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 475..494
AAA_25 [PF13481], Evalue: 0.0001, Aligned region: 612..644
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 210..347
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 614..697
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 210..233
AAA_18 [PF13238], Evalue: 0.00024, Aligned region: 616..652
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 203..227
AAA_29 [PF13555], Evalue: 0.00037, Aligned region: 613..640
DUF258 [PF03193], Evalue: 0.00082, Aligned region: 176..229
DUF258 [PF03193], Evalue: 0.00082, Aligned region: 614..627
AAA_23 [PF13476], Evalue: 0.0042, Aligned region: 210..226
AAA_23 [PF13476], Evalue: 0.0042, Aligned region: 442..492
AAA_23 [PF13476], Evalue: 0.0042, Aligned region: 613..641
Zeta_toxin [PF06414], Evalue: 0.0057, Aligned region: 208..231
Zeta_toxin [PF06414], Evalue: 0.0057, Aligned region: 614..655
Protein Sequence: 877 a.a.     [Download]
>gi|15596859|ref|NP_250353.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSMINVDLQQLIQALDADTRRDLEGSAERCVARGGSKVLVEDLLLGLLERPQGLLARALQDAAVDAGELN
AALQARGEHSASRNPVFAPELVQWLQDALLLANLELGRSQIDQAALILALLRNPLRYAGSRYQPLLARLD
IERLKDFALSQPLEGAPSGKPGGGESLLQRFTHNLTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPI
VVGEAGVGKTAIVEGLASRIAAGEVPPALRDVELLSLDMGLLQAGASVKGEFERRLKGVIDEVKAAPRPT
ILFIDEAHTLIGAGGQAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPSV
AEAVTILRGLARVYEESHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVLDTACARVRISLAAAPESLE
RLRGELAEGERQRQALRRDAEAGLPIDHDALQALEERLAQAESERHVQEDQWSRQRELAERLLALRQQLA
RAREANREEQGSEADAEAFPADEHGGVEALEKALHETRQALADAQAQGRLVSFEVCPRLVAEVIGAWTGV
PVEQLAREHNAKVMGFADDLRTRIRGQEQAVSALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETAL
ALADLLYGGERFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDV
LNLFYQIFDKGVANDGEGREIDFRNTLILMTSNLASEHIAALCQDGARPSAELLEETIRPALSRHFKPAL
LARMRVVPYYPVGGPVLRELIEIKLQRLGERLARRQLAFDYSQALVGHLAERCTQSDSGARLIDHLLDTH
LLPLVADRLLEAMARDERLERVHATLGEHGRVLCEFA
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1810751-1813384 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGCATGATCAACGTAGACCTGCAACAACTGATTCAGGCGCTGGATGCCGACACCCGGCGCGACCTCG
AAGGCTCGGCCGAGCGCTGCGTAGCCCGTGGCGGCAGCAAGGTACTGGTGGAGGACCTGTTGCTGGGTCT
GCTGGAGCGTCCCCAGGGACTGCTGGCGCGCGCCCTGCAGGATGCCGCGGTGGACGCCGGCGAACTCAAC
GCCGCGTTGCAAGCGCGGGGCGAGCACAGCGCCTCGCGCAATCCGGTGTTCGCGCCCGAGCTGGTGCAGT
GGCTGCAGGATGCGCTGTTGCTGGCCAACCTCGAACTGGGCCGTAGCCAGATCGACCAGGCGGCATTGAT
CCTGGCCCTGCTACGCAACCCGTTGCGCTATGCCGGCAGCCGCTACCAGCCGCTGCTGGCGCGGCTCGAC
ATCGAGCGGTTGAAGGATTTCGCGCTCTCGCAGCCGCTGGAGGGCGCGCCCAGCGGCAAGCCGGGCGGCG
GCGAGTCCCTGTTGCAGCGTTTCACCCACAACCTTACCCAGCAGGCGCGCGACGGCAAGCTCGATCCGGT
GCTCTGTCGCGACGGGGCTATTCGCCAGATGGTCGACATCCTGGCCCGTCGGCGGAAAAACAACCCCATC
GTGGTCGGCGAGGCTGGCGTCGGCAAGACCGCCATCGTCGAAGGCCTGGCCTCGCGGATCGCCGCAGGGG
AAGTGCCGCCGGCGCTGAGGGACGTCGAGCTGTTGTCCCTCGACATGGGCCTGTTGCAGGCCGGTGCCAG
CGTGAAGGGCGAGTTCGAGCGGCGCCTGAAAGGCGTCATCGACGAAGTGAAGGCAGCGCCCAGGCCGACC
ATCCTGTTCATCGACGAGGCCCATACGCTGATCGGCGCGGGCGGTCAGGCCGGCGGCTCGGATGCCGCCA
ACCTGCTCAAGCCGGCCCTGGCACGTGGCGAGTTGCGCACCATCGCGGCGACGACCTGGGCCGAATACAA
GAAGTATTTCGAGAAGGACCCGGCGCTGGCCCGGCGCTTCCAGCCCGTGCAGTTGCATGAGCCGAGCGTT
GCCGAGGCGGTGACGATCCTGCGTGGCCTGGCCCGGGTTTACGAGGAAAGCCACGGTATCTACCTGCGCG
ACGACGCGGTGGTGGCCGCCGCCGAACTGTCCGCCCGCTACCTGGCGGGTCGCCAGTTGCCGGACAAGGC
CGTCGACGTCCTCGACACCGCCTGTGCGCGGGTGCGCATCAGCCTGGCGGCGGCGCCGGAGAGCCTCGAG
CGCCTGCGCGGCGAGCTGGCCGAAGGCGAGCGCCAGCGCCAGGCCCTGCGCCGCGATGCCGAGGCAGGCC
TGCCGATCGACCACGATGCCCTGCAGGCGCTGGAGGAGCGCCTGGCCCAGGCGGAAAGCGAGCGGCACGT
ACAGGAGGACCAGTGGAGCCGCCAGCGCGAACTCGCCGAGCGCCTGCTCGCCCTGCGCCAGCAATTGGCC
AGGGCCCGCGAGGCGAACCGGGAAGAGCAGGGCAGCGAGGCGGACGCGGAGGCTTTCCCGGCCGACGAGC
ATGGCGGTGTCGAAGCCTTGGAAAAGGCCCTTCACGAAACCCGCCAGGCACTCGCCGATGCCCAGGCCCA
GGGGCGGCTGGTCAGCTTCGAGGTCTGCCCGCGCCTGGTTGCTGAGGTGATCGGCGCCTGGACCGGCGTA
CCGGTGGAACAACTGGCGCGGGAACACAACGCCAAGGTGATGGGGTTCGCCGACGACCTGCGGACGCGGA
TCCGTGGCCAGGAACAGGCGGTCAGCGCCCTGGACCGCGCGATGCGCGCCACCGCGGCCGGGCTGAACAA
GCCCGATGCGCCGGTCGGCGTGTTCCTGCTGGTGGGCCCGAGCGGGGTGGGCAAGACCGAGACCGCGCTG
GCGCTGGCCGACCTGCTGTATGGCGGCGAGCGTTTCATCACCACCATCAACATGTCCGAGTTCCAGGAGA
AGCACACCGTCTCGCGCCTGATCGGCGCGCCGCCCGGCTATGTCGGCTATGGCGAGGGTGGCATGCTCAC
CGAGGCGGTACGCCAGAAGCCCTATTCGGTGATATTGCTGGACGAGGTGGAGAAGGCCGATCCGGACGTG
CTCAACCTGTTCTACCAGATCTTCGACAAGGGCGTGGCCAACGATGGCGAAGGGCGCGAGATCGATTTCC
GCAATACCTTGATCCTGATGACCTCCAACCTCGCCAGCGAGCACATCGCCGCGCTTTGCCAGGACGGCGC
GCGGCCTTCCGCCGAACTCCTGGAGGAAACCATCCGGCCGGCGCTCAGCCGGCATTTCAAGCCGGCGCTG
CTGGCGCGCATGCGCGTGGTGCCTTACTACCCGGTGGGCGGCCCGGTACTGCGCGAGCTGATCGAGATCA
AGCTGCAACGCCTCGGCGAGCGCCTGGCGCGCCGTCAACTGGCTTTCGACTACAGCCAGGCGCTGGTGGG
CCACCTGGCCGAGCGTTGCACCCAGAGCGACAGCGGCGCACGGTTGATCGACCACCTGCTGGACACGCAC
CTGCTGCCGCTGGTGGCCGACCGTTTGCTGGAAGCGATGGCGCGCGACGAGCGTCTCGAGCGGGTCCATG
CGACGCTGGGCGAGCACGGGCGCGTGCTCTGCGAGTTCGCCTGA