SecReT6
Protein ID: 15596862
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1665
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1815153..1816346 [+]
Producthypothetical protein
NoteFha
UniProt IDQ9I360, Q9I360
KEGG IDpae:PA1665
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.80E-14, Aligned region: 30..96
FHA [PF00498], Evalue: 6.80E-14, Aligned region: 30..96
Protein Sequence: 397 a.a.     [Download]
>gi|15596862|ref|NP_250356.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MELVLEMLSAKQFVPTELCSKTFGRNGGLIGRGGECDWAIPDRKRHLSKQHARVSYRNGAFYLTDTSSNG
IRAGNGSRLPHGEPQRIEQDSVFLLGDFEIRARLLREPDELAMDVGRPQPAGSIIPDDAFLALDPLQALD
QDGADAYELDDLSAIAQPSHEAGARADYARIDMESLVVPELVPAPAAPQEPVESPPPERDEAFWQRFGQA
LGVDLEGLDGAAREALAIDAAGLLRQCIGGLQQSLRTRSELKNELRLSLSTLRDTGKNPLRFSADAGEAL
GHLLRDGKPGQLSGEQAVARSFRDLQAHQVALLGASRAAVRATLEHFSPQQLALRFERDGRRPLLATSGS
RWRAYGRYHQSLCQDDDWSERLLARDFAQAYEEQVRLISTLYTEHQG
 
Nucleotide Sequence: 1194 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1815153-1816346 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGAACTGGTATTGGAAATGCTCAGCGCCAAGCAATTCGTACCGACGGAGCTATGCAGCAAGACCTTCG
GCAGGAACGGCGGCCTCATCGGCCGCGGCGGTGAGTGCGATTGGGCGATTCCCGATCGCAAGCGGCACCT
GTCCAAGCAGCATGCGCGGGTCAGCTATCGCAACGGCGCGTTCTACCTGACCGACACCAGCAGCAACGGC
ATCCGCGCCGGCAACGGCAGCCGCCTGCCGCATGGCGAGCCGCAGCGCATCGAGCAGGACAGCGTCTTCC
TGCTCGGCGACTTCGAGATCCGCGCGCGGTTGCTGCGCGAGCCCGACGAGCTCGCCATGGACGTCGGGCG
GCCGCAGCCGGCGGGCAGCATCATTCCGGACGATGCCTTCCTGGCCCTCGATCCGTTGCAGGCGCTCGAC
CAGGACGGTGCAGATGCCTACGAACTCGACGACCTGAGCGCGATCGCCCAGCCCAGTCATGAGGCCGGGG
CGCGTGCGGACTACGCGCGGATCGACATGGAAAGCCTGGTCGTACCGGAGCTGGTGCCCGCCCCGGCGGC
TCCGCAGGAACCCGTGGAAAGTCCGCCTCCGGAACGCGACGAAGCCTTCTGGCAGCGTTTCGGCCAGGCG
CTCGGAGTGGACCTCGAAGGCCTCGACGGCGCTGCGCGCGAAGCGCTGGCGATCGACGCCGCCGGTTTGC
TGCGGCAGTGCATCGGCGGCTTGCAGCAGAGCCTGCGGACCCGCAGCGAACTGAAGAACGAACTGCGCCT
GTCGCTGAGCACATTGCGCGATACCGGCAAGAATCCCTTGCGCTTCAGCGCCGATGCCGGCGAGGCGCTG
GGTCATCTGCTACGGGATGGCAAGCCTGGCCAGTTGAGTGGCGAACAGGCCGTCGCACGCAGTTTCCGCG
ACCTCCAGGCACACCAGGTGGCGCTACTCGGCGCCAGCCGGGCGGCGGTGCGCGCGACCCTCGAGCATTT
CTCGCCGCAGCAGCTGGCCCTGCGTTTCGAGCGCGACGGTCGCCGGCCGTTGCTGGCCACCTCGGGCAGC
CGCTGGCGTGCCTATGGTCGCTACCACCAGTCGCTATGCCAGGACGACGATTGGAGCGAGCGTCTGTTGG
CGCGTGATTTCGCCCAGGCCTACGAAGAGCAGGTTCGCCTGATTTCCACCCTCTACACCGAGCACCAAGG
ATGA