SecReT6
Protein ID: 15596863
SecReT6 ID4
T6SS typei1
Gene symbol-
Locus tagPA1666
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H2-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]1816352..1816858 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ9I359
KEGG IDpae:PA1666
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-42, Aligned region: 19..154
Protein Sequence: 168 a.a.     [Download]
>gi|15596863|ref|NP_250357.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSRRPIPPARALAMLAVLALLAGCSTLSPYSRLTKLDLALSAGERVNPDLNGRPSPVVVRLFELKHPVAF
ENADFFSLYERPKETLDPDLVTSEELELRPGERVELKLSVEEGSRYVGVLAAYRDLGEASWRYVVPVTAK
ELTRVELKLGQKGILNAGELLGKAGDAR
 
Nucleotide Sequence: 507 bp     [Download]
>gi|110645304|ref|NC_002516.2|:1816352-1816858 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTCTCGTCGCCCGATCCCGCCAGCCAGGGCGCTGGCCATGCTCGCCGTCCTGGCGCTGCTGGCCGGCT
GTTCCACGCTGTCGCCGTATTCCAGACTGACCAAGCTCGACCTCGCCCTGAGCGCCGGCGAGCGGGTCAA
TCCCGACCTCAATGGCCGGCCGTCGCCGGTGGTAGTGCGGCTGTTCGAGCTGAAACACCCGGTGGCGTTC
GAGAACGCCGACTTCTTCAGCCTCTACGAACGTCCCAAGGAGACCCTGGACCCCGACCTGGTGACCAGCG
AGGAGCTGGAGCTGCGTCCCGGCGAGCGGGTCGAACTCAAGCTCAGCGTGGAGGAGGGGAGCCGCTACGT
GGGCGTGCTCGCCGCCTACCGCGATCTCGGCGAGGCAAGCTGGCGCTACGTGGTGCCGGTCACGGCGAAA
GAGCTGACCCGGGTAGAGCTGAAGCTGGGCCAGAAGGGCATCCTGAATGCCGGCGAATTGCTCGGCAAGG
CGGGTGACGCGCGATGA