SecReT6
Protein ID: 15597556
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2360
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2607132..2608232 [-]
Producthypothetical protein
NoteTssA
UniProt IDQ9I1B9
KEGG IDpae:PA2360
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 249..259
Protein Sequence: 366 a.a.     [Download]
>gi|15597556|ref|NP_251050.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MTLPLSGNALSLEVLLEPIDPGQACGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLLRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLSEEQPPVAEADASEG
DTDGEESVPASAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c2608232-2607132 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGG
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAAGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCGTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTAGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTACTGCGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCATTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGTCCGAAGAACAGCCCCCGGTCGCGGAGGCGGATGCCAGCGAAGGC
GACACGGACGGCGAGGAAAGCGTCCCGGCGAGCGCGCCGAGCGGGCCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTATCGGCAACTGCTGCTGATCGCCGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAGTGGGGCAACAAGCCGCTGAGCGAGTTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGGGTCTGGTCGCTGCTTGGCGTACTGCCCTAG