SecReT6
Protein ID: 15597558
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2362
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2612041..2612799 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ9I1B7
KEGG IDpae:PA2362
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.60E-46, Aligned region: 16..229
Protein Sequence: 252 a.a.     [Download]
>gi|15597558|ref|NP_251052.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MPEGSAGPFSQAYQEQPLSTAFRQAWQEWLEAWGALDRDAQDVPRMVERALELSTRITRRLWRSAFASVG
DAAGVQVKAMVYAFVALVDETLVFSAWPGQGAWQDKPLESHLYGSRQAGEYLPLAIKRLLDERAPASRDL
ANVYLQCLILGFRGRLRGPRGEALHEKWRQALFAFAWQREADAADLGRRLEQPAAAPPRRLPVRAALPDG
FRLGLAVLGLVLLMSGIGHLFWRDIQHEMAAVTHLADAEQAP
 
Nucleotide Sequence: 759 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c2612799-2612041 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCCCGAAGGGAGTGCAGGGCCTTTTTCCCAGGCGTACCAGGAGCAACCGCTCAGCACGGCATTCCGCC
AGGCCTGGCAGGAATGGCTGGAGGCCTGGGGCGCCCTCGACCGGGACGCCCAGGATGTGCCACGGATGGT
CGAGCGCGCCCTCGAACTGTCCACCCGCATCACCCGGCGTCTGTGGCGCAGCGCCTTCGCCAGCGTCGGC
GACGCGGCGGGCGTGCAGGTCAAGGCGATGGTCTATGCCTTCGTCGCCCTGGTCGACGAGACCCTGGTCT
TCAGCGCCTGGCCGGGGCAGGGCGCCTGGCAGGACAAACCGCTGGAGTCGCATCTCTACGGCAGTCGCCA
GGCGGGCGAATACCTGCCGCTGGCGATCAAGCGCCTGCTCGACGAACGCGCCCCGGCCAGTCGCGACCTG
GCCAACGTCTACCTGCAATGCCTGATCCTCGGCTTCCGCGGTCGCCTGCGCGGGCCGCGCGGCGAGGCGC
TGCACGAGAAGTGGCGGCAGGCATTGTTCGCCTTCGCCTGGCAGCGCGAGGCGGACGCCGCCGACCTCGG
CCGTCGCCTTGAGCAGCCCGCCGCTGCGCCGCCACGGCGTCTGCCGGTGCGCGCAGCGCTGCCGGACGGC
TTCCGCCTGGGCCTGGCGGTGCTCGGGCTGGTGCTGTTGATGAGCGGTATCGGACACCTGTTCTGGCGCG
ACATCCAGCACGAAATGGCGGCGGTGACCCACCTGGCCGATGCGGAGCAGGCGCCATGA