SecReT6
Protein ID: 15597559
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2363
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2612817..2614148 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ9I1B6
KEGG IDpae:PA2363
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.40E-69, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|15597559|ref|NP_251053.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSVLPDAVCWHEGMQLLPQHFQLQGLRAEALAARIGQACNPWFWGVTALELDPSALCAGQVRVLHLEAIL
PDGLPVSVQAGVDAPLEFDLETALAAAEGPLLNVHLAVSPLWRAGQLLPLKGRLQSRVGAPLPDLASGEH
PEPITVWRASLRLVGDDGKADSVCLPLLRVAKEGGAYVSLPYVPPTPLILPESPLGRRVQSLCARAREKA
LFLGGRLRLAQQAGNQDDAVEIRRQLAALWTRLPEVEGLLASRAASPLALHGSLLGLAGAWAALDPLAGV
PAFEALDFLDLRRGYEPLLDWLERAIESIRAGYRCLPFEQEEQVFSVRLPDPAPRQRLVVGLRMPAGAGE
QAAADWLERAIVASDPHLPLLARQRMSGLPRQPMNRQEQVAYSVGDDTRLFVVQGAGDWFDAGQPLRIVA
PVSGVASSPWQIVLFVADGSDNT
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|110645304|ref|NC_002516.2|:c2614148-2612817 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGAGTGTTCTGCCTGACGCGGTGTGCTGGCACGAAGGGATGCAACTGCTTCCCCAGCATTTCCAGTTGC
AGGGATTGCGTGCCGAGGCGCTGGCGGCGCGCATCGGACAGGCCTGCAACCCTTGGTTCTGGGGAGTGAC
CGCCCTGGAACTGGACCCCTCTGCGTTGTGCGCCGGCCAAGTGCGGGTCCTGCACCTCGAAGCGATCCTG
CCCGACGGCCTGCCGGTGAGCGTGCAGGCTGGTGTCGACGCGCCGCTGGAGTTCGATCTGGAGACAGCGC
TGGCGGCCGCCGAAGGGCCGCTGCTGAACGTCCACCTGGCGGTCAGTCCGCTGTGGCGGGCGGGTCAGTT
GCTGCCGCTGAAGGGCCGTCTGCAATCGCGGGTCGGCGCGCCGCTGCCGGACCTGGCCAGCGGCGAGCAC
CCCGAGCCGATCACCGTCTGGCGAGCGTCGCTGCGGCTGGTCGGCGACGACGGCAAGGCCGACTCCGTGT
GCCTGCCGTTGCTGCGCGTGGCGAAGGAGGGCGGCGCCTACGTCAGCCTGCCCTACGTCCCGCCGACGCC
ACTGATCCTGCCGGAGTCGCCCCTGGGCAGACGCGTGCAGTCGCTCTGCGCGCGGGCCCGGGAGAAGGCG
CTGTTCCTCGGCGGGCGCCTGCGCCTGGCGCAGCAGGCGGGCAACCAGGACGACGCGGTGGAAATCCGTC
GCCAGCTTGCCGCGCTCTGGACCCGCCTGCCGGAGGTCGAAGGCCTGCTGGCAAGCCGTGCGGCCTCGCC
GCTGGCCCTGCACGGCAGCCTGCTGGGCCTGGCCGGTGCCTGGGCGGCGCTCGATCCGCTGGCCGGCGTG
CCGGCCTTCGAAGCGCTCGACTTCCTCGACCTGCGGCGTGGCTACGAGCCGCTGCTGGACTGGTTGGAGC
GCGCCATCGAGTCGATCCGCGCGGGCTACCGCTGCCTGCCGTTCGAGCAGGAGGAACAGGTATTTTCCGT
GCGCCTGCCCGATCCGGCGCCGCGTCAGCGCCTGGTGGTCGGCCTGCGGATGCCCGCCGGCGCCGGCGAA
CAGGCGGCGGCTGACTGGCTGGAGCGCGCCATCGTCGCCTCCGACCCGCACCTGCCGTTGCTCGCCCGGC
AACGCATGAGCGGGCTGCCGCGGCAGCCGATGAATCGCCAGGAACAGGTGGCCTACAGCGTTGGCGACGA
CACCCGTTTGTTCGTCGTGCAGGGTGCCGGCGACTGGTTCGATGCCGGCCAGCCGCTGCGCATCGTCGCG
CCGGTCAGCGGGGTCGCCAGCAGTCCCTGGCAGATCGTGCTGTTCGTCGCCGACGGCAGCGACAACACCT
AG