SecReT6
Protein ID: 15597563
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2367
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2617019..2617516 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ9I1B2
KEGG IDpae:PA2367
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-35, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|15597563|ref|NP_251057.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MDAIILDFGSDIKGDSLLVGYENKIEIMSYSHNVAMQVTNDVSNSERTSGKPHVGEFTLTKFIDTSTPTL
NEYCCAGKPIAEATITIGRNAAEGNGQIMPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKDDGTKEGTAASTWDLAANQLVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|110645304|ref|NC_002516.2|:2617019-2617516 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGATGCGATCATTCTCGATTTCGGCAGCGACATCAAAGGCGACAGCCTGCTCGTCGGCTACGAAAACA
AGATCGAAATCATGTCCTACAGCCACAACGTGGCGATGCAGGTCACCAACGACGTCAGCAACTCGGAGCG
CACCTCCGGCAAACCCCACGTCGGCGAATTCACCCTCACCAAGTTCATCGACACCTCGACCCCGACCCTC
AACGAGTATTGCTGCGCCGGCAAGCCGATCGCCGAGGCGACCATCACCATCGGCCGCAACGCCGCCGAGG
GCAACGGGCAGATCATGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGCGCCGGCGGCAAGCCGGTGGAGACCCTGTCGCTGAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGGACGACGGCACCAAGGAAGGCACGGCCGCCTCAACCTGGGACCTGGCCGCCAACCAGTTGG
TCAAGTGA