SecReT6
Protein ID: 15597564
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2368
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2617529..2617954 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ9I1B1
KEGG IDpae:PA2368
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.00E-19, Aligned region: 25..116
Protein Sequence: 141 a.a.     [Download]
>gi|15597564|ref|NP_251058.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MSGALPPLFERLSAEADERPAFDDRALAESVRGELLRLLNTRRPANARSGILAYGLADWTAVQRLRAEDR
RQLAREVRAAVEHFEPRLQLAEVEVEPDPGNPQRLRIQLGGSLRSGSRLTPALFVIEQGCDGLEVRHERF
D
 
Nucleotide Sequence: 426 bp     [Download]
>gi|110645304|ref|NC_002516.2|:2617529-2617954 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGTCCGGAGCCCTGCCGCCGCTGTTCGAGCGCCTCAGCGCCGAGGCCGACGAACGTCCCGCGTTCGACG
ACCGGGCGCTGGCCGAGTCGGTCCGCGGCGAGCTGCTGCGCCTGCTCAACACACGGCGCCCGGCGAATGC
GCGCAGCGGCATCCTCGCCTACGGGCTCGCCGACTGGACCGCCGTGCAACGCCTGCGCGCCGAGGACCGA
CGCCAGCTGGCGCGCGAGGTGCGGGCGGCGGTCGAGCATTTCGAGCCGCGCCTGCAACTGGCCGAGGTCG
AGGTCGAACCTGACCCGGGCAATCCGCAGCGCCTGCGTATCCAGCTCGGCGGCAGCCTGCGCAGCGGGTC
GCGCCTGACGCCTGCGCTATTCGTCATCGAACAGGGCTGCGATGGCCTTGAGGTGCGCCATGAGCGATTC
GATTGA