SecReT6
Protein ID: 15597566
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2370
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2619695..2620711 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ9I1A9
KEGG IDpae:PA2370
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-79, Aligned region: 18..318
Protein Sequence: 338 a.a.     [Download]
>gi|15597566|ref|NP_251060.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MATPGRLAALPLSQRLRRTPQRFELLQALLLLERERPQALPLGTGNAPRAEALRLRGPLLPLFASSEVES
LLDDPQQPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHAPAEFLDLFQHRLLSLLYRVLRKHRVALG
FAVPAATPVQAQLRALSGLLPKALQERLALPDSAVLARTALFAGGRRSLAGFAGLVRQHFGVEARLDAYQ
GAWKEIPAASRSRLQRGGRNLRLGRDAIAGTRTWDEHAGIALSLGPLDAREAARFFPDGDAHGQLASLAA
LYFGPDLDCRLSLLVSGGAPLRLERGAPPRLSWNTGLRRVEDGQRQRIDLDLRQPEVA
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|110645304|ref|NC_002516.2|:2619695-2620711 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGGCAACCCCAGGCCGGCTCGCCGCTCTCCCTCTGAGTCAGCGGCTGCGCCGCACGCCGCAGCGCTTCG
AACTGTTGCAGGCGCTGCTGCTGCTCGAACGCGAGCGTCCCCAGGCGTTGCCGCTGGGCACCGGCAACGC
GCCGCGGGCGGAGGCCCTGCGCCTGCGCGGGCCGCTGTTGCCGCTGTTCGCCTCGAGCGAGGTGGAAAGC
CTGCTCGACGACCCGCAGCAACCGGTGCTGTCCACCCCGGTGTTCGGCCTCGGCGGACCCGACGGCCCGT
TGCCCTATGCCTACCAGGAATGGCTGCAACAACGCGCCCGGCAGAAGGACCATGCCCCCGCCGAGTTCCT
CGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTCTACCGGGTGCTGCGCAAGCATCGCGTGGCGCTCGGT
TTCGCGGTGCCGGCGGCGACCCCGGTGCAGGCGCAGCTACGCGCCCTCAGCGGCCTGTTGCCGAAAGCCC
TGCAAGAGCGCCTGGCGCTGCCGGACAGCGCGGTACTGGCACGCACCGCGCTGTTCGCCGGCGGGCGTCG
CTCCCTGGCCGGCTTCGCCGGCCTGGTGCGCCAGCATTTCGGCGTGGAGGCACGGCTGGACGCCTACCAG
GGCGCCTGGAAGGAAATCCCCGCGGCCAGCCGCAGCCGGCTGCAACGCGGCGGACGCAACCTGCGCCTGG
GTCGCGACGCCATAGCCGGCACGCGCACCTGGGACGAGCACGCCGGCATCGCCCTCAGTCTCGGTCCTCT
GGATGCCCGCGAAGCCGCCCGCTTCTTCCCCGACGGCGACGCCCATGGCCAGTTGGCCAGCCTCGCCGCG
CTGTACTTCGGCCCCGACCTGGATTGTCGCCTGAGCCTGCTGGTGAGCGGCGGCGCGCCGCTGCGCCTGG
AGCGCGGTGCACCGCCCAGGCTGAGCTGGAACACCGGCCTGCGGCGCGTCGAAGACGGCCAGCGGCAGCG
CATCGATCTCGACCTGCGGCAGCCGGAGGTAGCCTGA