SecReT6
Protein ID: 15597569
SecReT6 ID5
T6SS typei4a
Gene symbol-
Locus tagPA2373
StrainPseudomonas aeruginosa PAO1
Repliconchromosome (H3-T6SS) [GenBank: NC_002516] [Browse all T6SS(s) in this replicon]
Location [Strand]2624204..2626210 [+]
Producthypothetical protein
NoteTssI
UniProt IDQ9I1A6
KEGG IDpae:PA2373
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-71, Aligned region: 30..322
Phage_base_V [PF04717], Evalue: 5.20E-23, Aligned region: 351..444
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 536..557
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 560..583
Gp5_C [PF06715], Evalue: 1.50E-15, Aligned region: 641..654
Protein Sequence: 668 a.a.     [Download]
>gi|15597569|ref|NP_251063.1| unnamed protein product [Pseudomonas aeruginosa PAO1]
MPRPTDTNTTLSLSASTLGDLYPQTLSGGEALNELGSLTLGGYSATALTLSNAVATHLTATLHNDADQRP
LDGLVAEIRQLPGDASAERYQVLLRPWLWWLTLASNNRVFQNLATSDIVTQVFDQHGFSDYQLQLSGSYQ
PREYCVQYGESDLAFVSRLLEEDGIFWFFTHAAGKHTLVLADSNDAFPPIPNGPQVAYLGQGIGVRELQG
VRSAQYSLQAVSGTYSATDYEFTTPGTSLYSQAEAVSGAAGVYQHPGGYTAKAQGDSLTKQRIDGLRSQE
TRLIGESDCRWLVPGHWFTLSGHDDDSLNIDWVLTSVTHDASHAHYRNRFEAIPKATAYRPARVTPKPRM
HTQTALVVGKAGEEIWTDQYGRIKIQFPWDRDGKNDETSSCWVRVVLPWSGKGFGMQFVPRIGQEVIVTF
IDGDPDRPLVTGCVYNGDNALPYALPDNQTQSGIKTNSSKGGGGFNELRFEDKKDAEEVFLQAQKDLNVN
VLNDSTASIGHDETLTVQNARTRTVKEGDETVTLEKGKRTVTIQTGSDSLDVKDTRTVTVGADQTHSTGG
NYSHKVSGNFELTVDGNLTIKVSGTLALQSGGSLTLKSDADLAAQAGTSLTSKAGTSLTNQAGTSLTNKA
GTSLTNDAGVSLTNKAGAEQTVDGGGMLTIKGGLVKVN
 
Nucleotide Sequence: 2007 bp     [Download]
>gi|110645304|ref|NC_002516.2|:2624204-2626210 Pseudomonas aeruginosa PAO1 chromosome, complete genome
ATGCCCCGTCCCACCGACACCAATACCACCCTCTCCCTCAGCGCCTCCACCCTGGGTGATCTTTACCCCC
AGACGCTTTCCGGGGGCGAGGCGTTGAACGAGCTGGGCAGCCTGACGCTCGGCGGCTACAGCGCCACCGC
GCTGACGTTGAGCAATGCGGTGGCCACCCATCTCACCGCCACCCTGCACAACGACGCCGACCAGCGTCCG
CTCGACGGCCTGGTCGCGGAGATCCGCCAACTCCCCGGCGATGCCAGCGCCGAGCGCTACCAGGTGCTGT
TGCGCCCCTGGCTCTGGTGGCTGACGCTGGCCAGCAACAACCGGGTGTTCCAGAACCTGGCCACCAGCGA
CATCGTCACCCAGGTCTTCGACCAGCACGGCTTCAGCGACTACCAGTTGCAGCTCAGCGGCAGCTACCAG
CCCCGCGAATACTGCGTGCAGTACGGCGAGAGCGATCTCGCCTTCGTTTCGCGGCTGCTGGAGGAAGACG
GCATCTTCTGGTTCTTCACCCATGCCGCCGGCAAGCACACCCTGGTGCTGGCCGACAGCAACGACGCCTT
CCCGCCGATTCCCAACGGCCCGCAAGTGGCCTACCTGGGCCAAGGAATCGGCGTGCGCGAGTTGCAGGGC
GTGCGTTCGGCGCAGTACAGCCTCCAGGCGGTATCCGGGACCTACAGCGCCACCGACTACGAGTTCACCA
CCCCGGGCACCTCGCTGTACTCCCAGGCCGAGGCGGTTTCCGGCGCCGCCGGCGTCTACCAGCACCCCGG
CGGCTACACCGCCAAGGCCCAGGGCGACAGCCTGACCAAGCAACGCATCGACGGCCTGCGCAGCCAGGAG
ACGCGCCTGATCGGCGAGAGCGACTGCCGCTGGCTGGTGCCCGGCCACTGGTTCACCCTCAGCGGGCATG
ACGACGATTCGCTGAATATCGACTGGGTGCTGACCTCGGTCACCCATGACGCCAGTCACGCGCACTACCG
CAACCGCTTCGAGGCGATCCCCAAGGCCACCGCCTACCGCCCCGCGCGGGTCACGCCCAAGCCGCGCATG
CACACCCAGACCGCCCTGGTGGTGGGCAAGGCCGGCGAGGAGATCTGGACCGACCAGTACGGCCGGATCA
AGATCCAGTTCCCCTGGGACCGCGACGGCAAGAACGACGAGACCTCCTCCTGCTGGGTGCGCGTGGTGCT
GCCCTGGAGCGGCAAGGGCTTCGGCATGCAGTTCGTGCCGCGCATCGGCCAGGAAGTGATCGTCACCTTC
ATCGACGGCGACCCGGACCGCCCGCTGGTCACCGGCTGCGTCTACAACGGCGACAACGCCCTGCCCTACG
CGCTGCCGGACAACCAGACGCAGTCCGGGATCAAGACCAACTCGTCGAAGGGCGGCGGCGGTTTCAACGA
GCTGCGCTTCGAGGACAAGAAGGACGCCGAGGAAGTCTTCCTCCAGGCGCAGAAGGACCTCAACGTCAAC
GTGCTCAACGACAGCACCGCCAGCATCGGCCACGACGAGACCCTGACGGTGCAGAACGCCCGCACCCGCA
CGGTGAAGGAAGGCGACGAGACCGTCACCCTGGAGAAAGGCAAGCGCACGGTGACCATCCAGACCGGCAG
CGACAGTCTGGATGTGAAGGACACGCGCACGGTGACGGTGGGCGCCGACCAGACCCACAGCACCGGCGGC
AACTACAGCCACAAAGTCAGCGGCAACTTCGAGCTGACGGTGGACGGCAACCTGACCATCAAGGTCAGCG
GCACCCTCGCCCTGCAGAGCGGCGGCAGCCTGACCCTGAAGAGCGACGCCGACCTCGCCGCCCAGGCTGG
CACCTCGCTGACCAGCAAGGCCGGGACGTCGCTGACCAACCAGGCCGGCACCTCCCTCACCAACAAGGCC
GGCACCAGCCTGACCAACGATGCCGGCGTCAGCCTGACCAACAAGGCCGGCGCCGAACAGACGGTGGACG
GCGGCGGCATGCTGACCATCAAGGGCGGCCTGGTAAAGGTCAACTGA