SecReT6
Protein ID: 15600878
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0107
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]116846..117352 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ9KN58
KEGG IDvch:VCA0107
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-58, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|15600878|ref|NP_232508.1| hypothetical protein VCA0107 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKNNFEAVMRESE
LKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELREALVALKGPLGNIPAFRERL
QSLLNSEESREKLLAELNLLSGQEEPQA
 
Nucleotide Sequence: 507 bp     [Download]
>gi|15600771|ref|NC_002506.1|:116846-117352 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGTCTAAAGAAGGAAGTGTAGCTCCCAAAGAGCGGATTAATATCAAGTATATTCCGGCGACGGGGGATG
CACAGGCTGAGGTTGAGCTACCACTCAAAACCCTAGTTGTAGGTGATTTCAAAGGGCATGCGGAGCAAAC
CCCATTGGAAGAGCGTGCAACAGTCACGGTAGATAAGAACAACTTTGAAGCCGTAATGCGCGAGAGCGAG
CTGAAAATCACCGCCACGGTGAAAAACAAGCTGACTGATGATGAGAATGCCGAGCTTCCTGTTGAACTCA
ATTTCAAATCCTTAGCCGACTTCGCTCCTGATGCGGTGGCATCACAAGTTCCAGAACTGAAAAAATTGAT
TGAGTTGCGTGAAGCGTTAGTTGCCCTTAAAGGGCCGCTAGGCAACATTCCCGCATTTCGTGAGCGTTTA
CAGTCATTACTCAACTCAGAAGAGTCGAGAGAAAAGCTGTTGGCAGAACTGAATCTGCTCAGTGGTCAAG
AAGAGCCACAAGCGTAA