SecReT6
Protein ID: 15600879
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0108
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]117393..118871 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ9KN57
KEGG IDvch:VCA0108
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|15600879|ref|NP_232509.1| hypothetical protein VCA0108 [Vibrio cholerae O1 biovar El Tor str. N16961]
MMSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVNKSLVDQMLV
ELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTKDELLEDFEFAPETAQSGLY
KHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGALGAMAHAPFISSVGPEFFGIDSFEELPNIK
DLKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFA
FATRLTDSFAKYRWCPNIIGPQSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMR
KGSDNAAFFSANSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLE
RELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANFELSLVGRLD
QA
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|15600771|ref|NC_002506.1|:117393-118871 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGATGTCTACGACTGAAAAGGTATTGGAAAGGCCACAGCTTGCTCAAGGCAGCCTTCTTGATGAAATTA
TGGCGCAAACCCGTATCGCACCAAGCGAAGAGGGTTACGACATCGCGAAAAAAGGTGTTGCAGCGTTTAT
CGAAAATCTTATGGGTTCACAACACTCTGCTGAGCCTGTCAACAAATCTCTGGTTGACCAAATGTTGGTT
GAACTGGATAAAAAAATCAGTGCACAGATGGATGAAATCCTGCACAACTCACAATTCCAAGCGATGGAAT
CGGCGTGGCGCGGTTTGAAGCTGTTCGTGGATCGCACTGATTTTCGTGAAAATAACAAAGTCGAAATCCT
TCACGTAACCAAAGATGAACTGCTGGAAGATTTCGAGTTTGCTCCAGAAACGGCTCAGTCCGGTCTTTAC
AAGCACGTTTATTCTGCCGGTTATGGTCAATTTGGTGGCGAACCTGTTGGCGCGATCATTGGTAACTATG
CGTTTACCCCTTCAACGCCAGATATGAAGCTGCTGCAATACATGGGCGCACTGGGTGCCATGGCGCATGC
TCCTTTCATTTCAAGCGTAGGTCCTGAATTCTTTGGTATCGACTCCTTCGAAGAACTGCCTAACATTAAA
GATCTCAAGTCGACATTTGAAAGCCCGAAATACACCAAATGGCGTTCACTGCGTGAATCGGAAGATGCTC
GCTATCTTGGTTTGACTGCGCCTCGTTTCCTGCTGCGTGTTCCTTACGATCCAATCGAAAATCCAGTGAA
GTCGTTCAATTATGCGGAAAACGTCAGTGCTTCGCACGAGCACTACCTGTGGGGTAACACGGCATTTGCC
TTCGCAACTCGTTTGACGGATAGCTTTGCTAAATATCGCTGGTGTCCAAACATTATCGGTCCACAAAGTG
GTGGTGCAGTTGAAGATCTGCCGGTGCATGTCTTTGAATCTATGGGTGCATTGCAAAGCAAGATCCCAAC
CGAAGTCCTGATCACGGACCGTAAAGAATTTGAACTGGCGGAAGAAGGTTTTATTGCTCTTACTATGCGT
AAAGGCAGTGATAACGCGGCGTTCTTCTCTGCAAACTCCATTCAAAAACCTAAGGTTTTCCCAAATACCA
AAGAAGGCAAAGAAGCGGAAACCAACTACAAGTTGGGTACCCAGTTGCCGTACATGATGATCATCAACCG
TTTGGCGCACTATGTGAAAGTTCTGCAACGTGAGCAGATCGGTGCTTGGAAAGAGCGTCAAGATCTTGAG
CGTGAACTGAACTCATGGATCAAACAATACGTTGCTGATCAAGAGAACCCACCTGCAGACGTACGTAGCC
GTCGTCCACTTCGTGCTGCGCGCATTGAAGTGATGGATGTGGAAGGCAATCCAGGTTGGTATCAGGTGTC
GCTCTCGGTTCGTCCTCACTTTAAGTACATGGGTGCGAACTTTGAGTTGTCATTAGTTGGACGTCTTGAT
CAAGCCTGA