SecReT6
Protein ID: 15600881
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0110
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]119317..121086 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ9KN55
KEGG IDvch:VCA0110
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-209, Aligned region: 5..589
Protein Sequence: 589 a.a.     [Download]
>gi|15600881|ref|NP_232511.1| hypothetical protein VCA0110 [Vibrio cholerae O1 biovar El Tor str. N16961]
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVEDEFPELTHSI
INMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHFNTCRDVALYPMQCQGVHAEH
TREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQTLYLWLHHYLQKMTIEVQGVEFALPADAFST
VGFSSDQALLPYPKNVYDGYRILQEYLSFPEAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVR
QDNFQLYCTPVINLFEHDADPIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRI
YSSFESFQHEVERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLE
LGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSCVLRAYDFRAL
VDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSEGDLFLFGTVLSHFFALYASI
NSFHELVVVNISNQEKYSWGTQSGMQPLI
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|15600771|ref|NC_002506.1|:119317-121086 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGACGCAAGACAAGTATTTCAGGGAAGAGCTCGCTTTTTTAAAAGAGCAGGGGAAAGAATTTACCGAAA
TTCACCCTCAGCTTTCGCGTTTTCTTCATGGCCGTACGACCGATCCTGACGTTGAGCGTCTTCTGGAAGG
TTTTGCATTTCTTACCGCGCGTTTGCGCGAAAAGGTGGAGGATGAGTTCCCTGAACTTACTCACTCCATC
ATTAACATGCTGTGGCCAAATTATCTGCGCCCTATCCCGAGCATGAGTGTGGTGGCGTTTGAACCTGACA
AAAGTGTCAGCGAGAAGCAAGTCATCCCACGTAATACCCAATTGGATAGCAAGCCAGTCTTTGGCACGGC
GTGTCATTTCAACACTTGCCGTGATGTCGCGCTGTATCCGATGCAGTGTCAAGGTGTTCATGCCGAGCAC
ACACGTGAAGCCACGACCATTCAGATCTCGTTGCGCATGCTGGGCGATATGACAGTAGGCGACGCTAAGC
TCGATACCGTACGTTTTTACTTAGGTGGTGATAAATACAGCTCGCAGACTCTCTATCTTTGGTTACACCA
TTATCTACAAAAAATGACCATTGAAGTGCAAGGTGTCGAGTTCGCACTGCCTGCTGATGCGTTTTCAACC
GTTGGTTTCTCAAGTGACCAAGCTTTGCTGCCTTATCCAAAGAATGTCTATGACGGTTATCGTATTTTGC
AAGAGTACCTGTCGTTTCCTGAAGCCTTTCACTTCTTTGATGTAAAAGGTTTTGCCAAAGCTTTACCGAA
AGCGGTCAGCGGTGATTTCACCTTACGCATCCATTTTTCGAAAACATTGCCTGCTGATACGCGAGTGCGT
CAGGACAATTTTCAACTCTATTGCACACCGGTCATCAATCTGTTTGAGCATGATGCCGATCCGATCGATT
TGACTGGGCGTCGTTCAGAGTATCGAATCGTCCCGTCCAGTCGCTATCCTGCCCACTATGAAATTTTCAG
CGTGGATCAAGTGGTTGGTTGGCAAGATACCCAGTCAGAAGGCAAACGGATCCGCGGAGAGAAGCGTATC
TACTCTTCTTTTGAAAGCTTCCAACATGAAGTGGAACGGGTTCGTCATCGTCAAGCGCTTTACTATCGCA
CACGAGTCAAAGAGAGCATCCGGGGGGATGGTTTTGATTCATTTATCTCTTTTGTGCGCGGTGATGAAAC
CTTATCAATGGGCGTAGATGAAGCCGTCTCAATCAAACTCACCTGCACCAATCGCTTGCTGCCATTGGAA
CTTGGGGTGGGGGATATTTGTGTGGCGACCGACAGCTCACCCCCTTTTGCCACATTTAAAAATATTACGG
TGCCTTCGCAGTCACTGCGCCCGGTTCTCGATGGCAGCTTACTGTGGACGCTGATCTCGAATCTATCGCT
GAACTACCTATCACTGCTTTCAAAAGATGCACTGAGCTGTGTGCTACGCGCTTACGATTTTCGCGCCTTG
GTCGATAGGCAAGCTGAACGTGTCGCACGGATGCGCCTTGATGGCATAGTCAAAATAGAATCTAAACCGG
TTGATAAAATCCTACGTGGTTTGCCTGTGCGTGGTTTGCAATCGACTTTGTATGTCGATCAAGCGGGATT
TGGCTCGGAAGGTGATTTGTTCCTGTTTGGTACGGTACTCAGTCATTTCTTTGCACTTTACGCCAGCATC
AACTCATTTCACGAATTAGTCGTGGTTAACATCAGCAATCAAGAGAAGTACTCATGGGGCACACAGAGCG
GAATGCAGCCGTTGATCTGA