SecReT6
Protein ID: 15600882
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0111
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]121050..122066 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ9KN54
KEGG IDvch:VCA0111
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-93, Aligned region: 27..325
Protein Sequence: 338 a.a.     [Download]
>gi|15600882|ref|NP_232512.1| hypothetical protein VCA0111 [Vibrio cholerae O1 biovar El Tor str. N16961]
MGHTERNAAVDLNSDPAQASPLSLPGNVREYNFYQLVELLQKLADINPESEEWERDCRLVFSANPSLGFS
PSDVMALEARDDERWVMLTNFFGLSGAQSPLPGFILEQLVTEEPGGYKQPFLDFFNNRLINLVYRVWRKY
RYYVRFQPGAQDVFSAQLFALVGLGDPDLRGETPINWCKMLAYAGTLAGRSRSPQVVAGIIAHCFDLPDV
SIRQWVRRRVSIDRSQQLALGKQNARLGMDTVIGESVIDCSGKFIICIKRLSRSRFADFLPSGKEYQPLC
KLVEFILREQMAYDLELAMDEREAPLFCLDTRQNIALGWTSFLGQDAANKHVLIQVRQ
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|15600771|ref|NC_002506.1|:121050-122066 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGGGGCACACAGAGCGGAATGCAGCCGTTGATCTGAATTCAGATCCAGCGCAAGCCTCTCCGTTGAGCT
TGCCGGGCAATGTACGGGAATACAACTTCTACCAACTGGTTGAGCTGTTGCAAAAACTGGCTGATATCAA
TCCCGAATCGGAAGAGTGGGAGCGCGATTGCCGCTTGGTGTTCAGTGCTAACCCGAGCCTTGGATTTTCG
CCCAGTGATGTGATGGCGCTTGAAGCGCGTGACGATGAGCGTTGGGTTATGTTGACCAACTTTTTTGGCC
TTTCCGGTGCACAGTCACCTCTGCCGGGGTTCATCCTTGAGCAATTGGTGACGGAAGAGCCTGGGGGATA
TAAGCAGCCGTTTCTCGATTTTTTCAATAACCGATTGATTAATTTGGTTTATCGCGTTTGGCGTAAATAC
CGTTACTACGTACGTTTTCAGCCCGGTGCGCAGGATGTGTTCTCTGCACAGCTGTTTGCGCTGGTGGGGT
TGGGCGATCCTGACCTTCGCGGTGAAACGCCGATCAACTGGTGCAAAATGCTGGCTTACGCGGGCACGCT
GGCCGGACGTAGCCGTTCGCCACAAGTTGTGGCCGGCATTATTGCTCACTGTTTTGATTTACCGGATGTC
TCCATTCGCCAGTGGGTCAGACGTCGGGTATCGATTGATCGGAGTCAGCAACTGGCGCTGGGCAAGCAGA
ATGCGCGGTTGGGGATGGACACGGTGATTGGCGAGTCCGTTATTGATTGCAGTGGAAAATTTATTATCTG
TATCAAACGGTTATCTCGCAGTCGTTTTGCTGATTTTTTGCCCTCCGGTAAAGAGTATCAGCCACTTTGC
AAGCTGGTGGAGTTTATTTTGCGCGAACAGATGGCGTATGACCTCGAGCTGGCGATGGATGAACGAGAAG
CGCCGCTGTTTTGTCTGGATACTAGACAGAATATCGCCCTCGGCTGGACTTCGTTTCTTGGCCAAGATGC
AGCCAATAAACATGTGTTAATTCAAGTAAGGCAATAA