SecReT6
Protein ID: 15600883
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0112
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]122069..123556 [+]
Producthypothetical protein
NoteFha
UniProt IDQ9KN53
KEGG IDvch:VCA0112
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.30E-06, Aligned region: 35..102
Protein Sequence: 495 a.a.     [Download]
>gi|15600883|ref|NP_232513.1| hypothetical protein VCA0112 [Vibrio cholerae O1 biovar El Tor str. N16961]
MNSVTLPSLTLLVTNAQHLESGLSAQHTWTSSGGVIGSSPNAQWRLVDAQGSVKPMHCEVMMVDGAYCLK
DSCGSTYVNGADMPLGVGQMARLTHKDEVSVGPYRLRVLFGNAIEVEEQYGSLDALFASKDEDLLADLTL
DIEPEKHELPTNTDPLQALDNLMGAAGSSTSLLDDPKSEQPLSAQPSLVPQDNLVLQNADFTPQADSEYE
MTSSIRLKKILGFAKATFAKQTKSEAPNVTSATPTISQYKTSESNVSEGFTMDEKVLDLLEEEVAKSFQP
QLEKSAYSTMHTSSTSQANHLVTGPILEGLGVDLSDENDMNRMHLLSQELGESLQACVRGLLDLHQQVSE
SRFGTLNRNLQPIEDNPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKTVRDHNEAMQFATSEALS
QILNAFSPQVMLRRFHHYKRNSDTTQTSTDAWAWNMYCSYYQELTSNRQRGFEKLFWEIFEQAYDRKIRE
KQLEL
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|15600771|ref|NC_002506.1|:122069-123556 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGAACTCAGTGACATTACCTTCGTTGACCCTATTAGTCACCAATGCTCAGCACTTAGAGTCTGGCTTGT
CCGCTCAGCATACGTGGACCTCGTCAGGTGGGGTGATCGGCTCATCGCCGAATGCGCAGTGGCGTTTGGT
CGATGCGCAAGGCAGTGTAAAACCCATGCACTGTGAAGTGATGATGGTAGACGGGGCGTATTGTTTAAAA
GACAGCTGCGGCAGCACGTATGTCAACGGGGCAGACATGCCACTGGGCGTTGGGCAAATGGCACGTCTGA
CTCACAAAGATGAAGTGAGTGTGGGGCCTTACCGTTTGCGAGTGCTGTTTGGTAACGCCATCGAAGTGGA
AGAACAATATGGATCTTTAGATGCGCTGTTTGCCTCTAAGGATGAGGATCTGCTAGCGGATTTGACGCTC
GACATCGAACCAGAAAAACACGAATTACCAACCAATACAGACCCATTACAGGCGCTCGATAACCTGATGG
GTGCGGCGGGCAGTTCGACCTCCTTACTGGATGATCCTAAAAGTGAGCAGCCGTTATCCGCCCAACCTAG
CCTCGTGCCACAAGATAACTTAGTGCTGCAAAATGCCGATTTTACGCCACAAGCGGACAGTGAGTATGAG
ATGACCTCATCGATCCGCCTTAAGAAAATTCTTGGTTTTGCGAAGGCCACCTTTGCTAAGCAAACCAAAT
CAGAAGCACCGAACGTGACTTCTGCCACCCCCACAATTTCTCAATATAAAACCAGCGAAAGCAACGTATC
AGAGGGCTTCACAATGGATGAAAAAGTACTGGATTTGTTAGAAGAGGAAGTCGCGAAAAGTTTCCAACCG
CAGTTGGAGAAAAGCGCGTATTCCACTATGCACACAAGCTCAACCAGCCAAGCTAACCACTTGGTGACAG
GTCCGATCTTGGAAGGGCTCGGCGTAGATCTGAGCGATGAAAATGATATGAATCGTATGCATCTTTTATC
GCAAGAGTTGGGTGAGTCTTTGCAAGCTTGTGTGCGCGGTTTACTCGATTTGCATCAACAAGTGAGTGAA
AGCCGTTTCGGTACTTTGAACCGTAATCTGCAACCCATTGAAGATAACCCGCTGCGTTTAGGTCTCTCCT
ATGAAGAGACGATCCGCACTCTGTACGATGCCGACAAGAGCGTCGTGCACCTTTCTGCCCCTGCGGCGAT
TGCTGAAAGCCTAAAAACCGTTCGCGATCATAATGAAGCGATGCAGTTCGCCACGTCAGAAGCCTTGAGC
CAAATTCTCAACGCTTTCTCACCACAGGTGATGCTGCGCCGTTTCCACCACTACAAGCGCAATTCTGATA
CCACACAAACTTCAACGGATGCTTGGGCGTGGAATATGTACTGCAGCTACTACCAAGAGCTGACCTCTAA
CCGCCAACGCGGCTTTGAGAAGTTGTTCTGGGAGATCTTTGAGCAAGCCTACGATCGCAAAATTCGCGAG
AAGCAACTGGAGCTATAA