SecReT6
Protein ID: 15600884
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0113
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]123559..124035 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ9KN52
KEGG IDvch:VCA0113
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.80E-38, Aligned region: 12..148
Protein Sequence: 158 a.a.     [Download]
>gi|15600884|ref|NP_232514.1| hypothetical protein VCA0113 [Vibrio cholerae O1 biovar El Tor str. N16961]
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFELKDDSMFMSSD
YDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHFAEPELSEWKKAVKVINKGRE
YHLLMLFKDYDVKLDRVE
 
Nucleotide Sequence: 477 bp     [Download]
>gi|15600771|ref|NC_002506.1|:123559-124035 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
GTGAACAAAGTGCTGTGGATGCTGTTTGCCTTGACGGTACTGACCGCGTGCAGTTCGTCGGATAAGTACG
AGCCTGCGAAAGAGCCGACCAAGGTGACTTTTAGCTTAGTCAGCGATGAAGGGGTGAACCCGAACATCTG
GGGTGAAGCGTCACCGATAGAAATTCAAGTTTTTGAGCTAAAGGATGACTCGATGTTTATGTCGTCCGAC
TACGACCAGATCAAAACCGATTATAAAAAAGCGCTGCGCAGTAACTTTGTTAAAAACTACGACTATGTAC
TGACTCCAGGGCAGTTCAAATTCGTCAACGCTTTCGAAGTCGATGAGGAGACCAACTACATCGGCGTGAT
GGCTCATTTTGCCGAGCCTGAACTCAGCGAATGGAAGAAAGCGGTCAAGGTGATCAATAAAGGGCGAGAG
TATCACTTGCTGATGCTGTTTAAAGACTACGATGTGAAATTGGATAGGGTGGAATAA