SecReT6
Protein ID: 15600886
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0115
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]125379..126152 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ9KN50
KEGG IDvch:VCA0115
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-69, Aligned region: 37..242
Protein Sequence: 257 a.a.     [Download]
>gi|15600886|ref|NP_232516.1| hypothetical protein VCA0115 [Vibrio cholerae O1 biovar El Tor str. N16961]
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECDNIEQIYRQTI
EEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHSMLSRFHNETWGGEKVFTILS
RLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREKVISRLHQLLSSLEESEPQDLTRPTDHVVRA
KYTLSRQMPVWSVFAGFIVLWVGLFLGYSYVLHSKSSDVLNQLNQIL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|15600771|ref|NC_002506.1|:125379-126152 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
ATGTCACAGAGTAAAAAAGAGACGCCATTAGCCAGTTTGTTGTTCGACGATGTGGAAAAAATTAACCACG
ACCAAGACTACTGGTTCCAATTGCGTGGGGACAATCCGAATGTGCTGATTGATGCCGCGACACCCTTGTT
TGGGCTTTCTCTGCGGGTTCGTACCCTCACCGAATGCGACAACATTGAACAGATCTACCGTCAGACGATT
GAAGAGATCAAAGCGATTGAAATTGAGTTGACGGAGCAAGGTTACGAACACGCCATTTTGATGGCCTATC
GCTACATCTTGTGCGCCTTTTTGGATGAATCCGTGATGGGAACCGAGTGGGGCGCGTCCAGTTTATGGGC
CGAGCACTCCATGCTGTCACGCTTCCATAATGAAACGTGGGGTGGCGAGAAAGTGTTTACGATTTTGAGC
CGTCTTGAGGGTGAACCACACCGTTACCAAGCGCTATTGGCCTTTATTTATCATTGCCTGATTTTGGGCT
TTGAAGGCAAATACCGTGTGATGGAAGGGGGACAAGCTGAGCGCGAAAAAGTGATCAGCCGCCTGCATCA
ACTGCTGAGCAGCTTGGAAGAGAGCGAGCCACAAGACTTAACCCGTCCGACCGATCATGTGGTGCGTGCG
AAATATACCCTAAGCAGACAGATGCCTGTTTGGTCTGTGTTTGCTGGCTTTATCGTGCTTTGGGTAGGTC
TATTTCTCGGCTACAGCTATGTACTGCATAGCAAATCCAGCGATGTGCTCAATCAACTCAATCAAATACT
TTAA