SecReT6
Protein ID: 15600889
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0118
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]130352..131035 [+]
Producthypothetical protein
NoteVCA0118
UniProt IDQ9KN47
KEGG IDvch:VCA0118
PDB IDNA
Domain hit(s) vs Pfam DUF3121 [PF11319], Evalue: 5.30E-59, Aligned region: 41..221
Protein Sequence: 227 a.a.     [Download]
>gi|15600889|ref|NP_232519.1| hypothetical protein VCA0118 [Vibrio cholerae O1 biovar El Tor str. N16961]
MPEIGDQNPMRITVLVVSLILGCAGSAHVLAASQDAGSQVEQAELCREIPARLERLACFDRVFATPLEQV
AIAPSNPYPAEWQRAMAALSESQSEAGWVLGTQGEGRGSSAWIALPAQNRSSGETSPPVLLLSCINNLSR
IELALPKEVADARIQVSIRHETQFWRSDDHGVLFSSARGMPAIEMMKLAASESRLLLRSNAPFADGLQFD
TRGVNEALDALRERCGW
 
Nucleotide Sequence: 684 bp     [Download]
>gi|15600771|ref|NC_002506.1|:130352-131035 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
GTGCCTGAAATTGGAGATCAAAACCCCATGAGAATTACCGTTTTAGTGGTCAGTTTGATCTTGGGTTGCG
CGGGCTCTGCGCATGTTTTAGCAGCATCGCAAGATGCGGGCTCACAGGTTGAGCAAGCTGAGCTGTGCCG
CGAAATTCCTGCGCGTTTAGAGCGTTTGGCTTGTTTTGACCGTGTCTTTGCCACGCCCCTTGAGCAAGTG
GCTATCGCACCGTCCAATCCTTATCCCGCAGAGTGGCAACGCGCCATGGCGGCATTGTCTGAGTCGCAGT
CCGAAGCGGGTTGGGTATTAGGTACGCAAGGTGAAGGGCGGGGCAGCAGCGCTTGGATTGCTTTGCCTGC
GCAAAATCGCAGCTCAGGGGAAACATCTCCGCCAGTGCTCTTGCTCAGTTGCATTAATAACCTGAGCCGC
ATTGAGCTGGCTTTACCGAAAGAAGTGGCTGATGCACGGATTCAAGTCTCTATCCGACACGAGACACAGT
TCTGGCGCAGTGACGATCACGGCGTACTGTTTTCCTCGGCTCGCGGCATGCCTGCGATCGAAATGATGAA
ATTGGCCGCCAGTGAGTCTCGCCTGTTGCTGCGTTCTAATGCGCCCTTTGCTGACGGGTTACAGTTTGAT
ACTCGAGGTGTCAATGAAGCCCTTGATGCTTTGCGCGAACGCTGTGGTTGGTAA