SecReT6
Protein ID: 15600892
SecReT6 ID2
T6SS typei1
Gene symbol-
Locus tagVCA0121
StrainVibrio cholerae O1 biovar El Tor str. N16961
Repliconchromosome II (Vas) [GenBank: NC_002506] [Browse all T6SS(s) in this replicon]
Location [Strand]136063..137328 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ9KN44
KEGG IDvch:VCA0121
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.20E-11, Aligned region: 47..101
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 120..136
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 172..185
Cytochrom_B562 [PF07361], Evalue: 0.0063, Aligned region: 325..397
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 123..160
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 296..340
Uds1 [PF15456], Evalue: 0.0075, Aligned region: 380..418
Protein Sequence: 421 a.a.     [Download]
>gi|15600892|ref|NP_232522.1| hypothetical protein VCA0121 [Vibrio cholerae O1 biovar El Tor str. N16961]
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLACNQGMDFLICG
YYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNARVVQELKALKPTYESLRDLYR
AERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQYHSLLKKQEKAQPPKLKFWQRGYALFTLGV
LGVALGMVGGYWGWPWFYTTPYAAPQRITTLNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTI
SFSEPKRHAITQLNLLRTLYPENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKW
AELEKQTKSLEEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|15600771|ref|NC_002506.1|:136063-137328 Vibrio cholerae O1 biovar eltor str. N16961 chromosome II, complete sequence
GTGATGTCCAATGTGATTTTTATTGATAACGTTTGCTACCGATTAACCAATGATTCTGAGGAGATTCGCG
GATTAGAGCCCTATGCGAAGGTTCGTGAGGAGATAAACCGCCGCTTCAATCCGATTGCTGGGGGCACGGA
TTGGGCAGTGGTAAAAGAGTACTGTGAACAACTGGCCTGTAACCAAGGAATGGATTTTCTGATCTGCGGT
TACTATGCGGTAGCCTGCCTGAAAACTCAGGGGTTAGCGGGGTATGCCACCGGTATGGAGCTGATGAGTG
CAAGCCTTGCCAACCAAGGTGAGTGTGATGTGAAAAGCGCCAAAGTGCGCAAAGAGATCCTTGATTGGGT
CAATGCACGTGTGGTGCAGGAACTGAAAGCACTTAAGCCAACTTATGAGTCGCTGCGAGATCTGTATCGG
GCTGAGCGCCATTGCGAGCGGTTACATCAGCTGTTTGAACAGCAACAAACCGAATACAAAGTAGACTTTG
AAGGGGTCGGGTTTGCTCTGTTTGAACACATAGACAGAATTGAAACCCAATACCACAGCTTATTGAAAAA
GCAGGAGAAGGCTCAGCCACCTAAGCTTAAGTTTTGGCAGCGCGGTTACGCGTTGTTCACTCTAGGTGTA
CTCGGGGTTGCACTGGGAATGGTGGGGGGCTACTGGGGGTGGCCTTGGTTTTATACCACGCCTTATGCCG
CGCCACAGCGCATCACTACGTTGAATGAGGCCTCTCAAACTCAAGCACTGCTCAACGACTCTTCCACAAG
TGAGCGTGCGCGTTGGCAACATGATCTGATCCCGCTGTATCGCGATACTTTGCAGCAGAATTTAACCATC
TCGTTTAGTGAACCTAAGCGACATGCCATCACTCAGCTGAATCTATTGCGCACTCTTTATCCTGAAAACG
AGCAAGTGAATGCACTGAGTCAAGAGTTTGCCCTTCAGCAGCAACAAGCGTTGGAGCAAACCGCGCTGTT
CGTGGCTAAGTTCAGCGAAATTCGCACCAAAATGGCCAATATCTCGTTATTGGCTAAGCGAGGGAAATGG
GCTGAGTTAGAAAAGCAGACCAAATCATTAGAAGAGTTCGCGGTCAGCCTATCACCGATTTATGGTCGAG
TTGACTATGTGCAAGGCCTCCTTGAACAGGGCGATGTCACAAATGCCCAGAAAGAGTTTGCGATCCTCAA
ACAAAGGCTAGATAGCCTAAGTTGGAAAATTGCCGAGCTTGAGCAGCGTATCGGCGATGCGGCTTTGTTG
CAGTGA