SecReT6
Protein ID: 156932366
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_00141
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]125547..126155 [+]
Producthypothetical protein
NoteTssL
UniProt IDA7MMD3
KEGG IDesa:ESA_00141
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-21, Aligned region: 10..190
Protein Sequence: 202 a.a.     [Download]
>gi|156932366|ref|YP_001436282.1| hypothetical protein ESA_00141 [Cronobacter sakazakii ATCC BAA-894]
MDVHHQPALVRDEALYRRAVKLVEAVQEKLNARKERDVFIHHVIYAQCAMMDDAVLNSASSEDNYVWLRN
PLQALFIGQMRAGEVMPERTRALLREAAPDPRLLVLYQRLYGMGYSQRWMEISPDHAFRENTAELTESLN
TLVPAGEQPLSAALVVERHPTIRGRLLRSRMVHITLAFLLTAGLIALLQSSLQHLLQSALPG
 
Nucleotide Sequence: 609 bp     [Download]
>gi|156932229|ref|NC_009778.1|:125547-126155 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGATGTTCATCATCAGCCTGCGCTGGTACGTGACGAGGCGCTGTATCGCCGCGCGGTGAAGCTGGTGG
AGGCTGTGCAGGAAAAACTGAACGCCAGAAAGGAAAGAGACGTTTTCATTCACCACGTTATTTATGCACA
GTGCGCCATGATGGATGACGCGGTACTGAACAGCGCCTCTTCTGAGGATAACTACGTCTGGCTGCGAAAC
CCGCTGCAGGCGCTGTTTATCGGGCAAATGCGGGCCGGAGAAGTGATGCCAGAACGGACGCGGGCGCTGC
TGCGGGAGGCCGCGCCAGATCCGCGTCTGCTGGTGCTCTACCAGCGTCTGTATGGCATGGGCTACAGCCA
GCGGTGGATGGAAATATCTCCGGATCATGCCTTTCGGGAGAATACGGCTGAACTCACCGAGTCCCTGAAT
ACGCTGGTGCCAGCCGGTGAACAGCCCTTGTCTGCTGCGCTGGTGGTGGAGCGCCACCCGACGATACGCG
GCCGGTTACTCCGTTCCCGCATGGTCCATATCACGCTGGCATTTTTGCTGACTGCCGGGCTGATAGCGCT
CCTGCAATCTTCATTACAACATTTACTTCAGTCAGCCCTGCCGGGCTGA