SecReT6
Protein ID: 156932368
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_00143
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]129340..131100 [+]
Producthypothetical protein
NoteTssF
UniProt IDA7MMD5
KEGG IDesa:ESA_00143
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.30E-169, Aligned region: 6..580
Protein Sequence: 586 a.a.     [Download]
>gi|156932368|ref|YP_001436284.1| hypothetical protein ESA_00143 [Cronobacter sakazakii ATCC BAA-894]
MEDLTLRYFDTEMRYLRDAAREFAQQHPEEARQMGLMKNGAMDESVERLFQGFAFLMGRVRQKLDDDYPE
LTEGVISLLWPHYLRPLPSMCVVEIAPDPDALKHSDIIPEHTEVISAPVGDNHVRCRYRTTRPLTLQPLL
IEKAGIFTEPDGENTLRLRFQCGNTADWQQLDLSALPVYLNGDAPLASLLHLFLTRLVGQAYIRFPGNVD
RHPLSLRFRASAFDEDAHLWDVEKSEYSGYQHLLEYFTFREKFMFVSLEGLEQADWPEALPWFELELRFT
RPWPHDFSVSEENLRLHCVTAVNLFRLDARPLAINSEQTEYRLQPLRDDDPHTEIFAVESVAASSEEDAP
RYTSFRLFEQRGGMLRRERPPRYFHTRVLRGPSGRTETWLIPGGEAFERERQQPDEALVLSLTGTNGSLP
RKTLQSILLNQLAGTPQTPVRVRNLCRPSMPCYPPNENRFHWKLLSQLGSRFLWMMNDAEMLRNALALYN
WTEDDTNRRRLSGIIKVQHHRLEYWKRGLQRGVDIEVTLDTTMFAGEGDVWLFGSLLNRFFAQYADMHLF
NRLTLILQPTGHCLRWKENHQSASRG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|156932229|ref|NC_009778.1|:129340-131100 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGAAGATTTAACCCTCCGCTACTTTGACACCGAAATGCGCTATCTGCGCGATGCGGCACGGGAGTTTG
CACAACAGCACCCAGAAGAGGCCCGCCAGATGGGGCTCATGAAGAACGGGGCGATGGACGAATCGGTTGA
GCGCCTGTTCCAGGGTTTTGCTTTCCTGATGGGGCGAGTGCGTCAGAAACTGGACGACGATTATCCGGAA
CTCACCGAAGGGGTTATCAGCCTGCTGTGGCCGCACTACCTGCGTCCGCTGCCGTCGATGTGCGTGGTGG
AAATCGCACCGGACCCCGATGCGCTTAAGCACAGTGACATCATCCCTGAACATACCGAAGTGATTTCTGC
GCCAGTGGGAGACAATCACGTACGCTGCCGCTACCGCACCACACGACCGCTGACCCTGCAGCCACTCCTG
ATTGAGAAAGCGGGTATCTTTACCGAGCCGGACGGCGAGAATACCCTGCGCCTGCGCTTTCAGTGCGGTA
ACACCGCCGACTGGCAACAACTGGATCTTTCGGCTCTGCCGGTCTACCTGAATGGCGATGCGCCGCTGGC
CTCGCTGCTGCATCTGTTTCTGACCCGGCTGGTGGGACAGGCATATATCCGCTTTCCTGGTAACGTGGAT
CGCCATCCTCTGTCGCTGCGTTTTCGCGCCAGCGCCTTTGATGAAGACGCGCATCTGTGGGATGTGGAGA
AGAGTGAGTACAGCGGCTATCAGCATCTGCTGGAGTATTTCACTTTCCGCGAAAAGTTTATGTTCGTCTC
CCTGGAAGGGCTGGAGCAGGCTGACTGGCCGGAAGCGTTGCCGTGGTTTGAGCTGGAGCTGCGCTTCACA
CGGCCCTGGCCGCATGATTTTAGCGTCAGCGAAGAGAACCTGCGCCTGCACTGCGTGACGGCGGTGAATC
TGTTCCGCCTTGATGCACGTCCGCTGGCGATTAATTCAGAGCAGACCGAATACCGCTTACAGCCGCTGCG
TGATGACGACCCGCATACTGAAATCTTTGCGGTTGAATCCGTGGCGGCCTCGTCTGAAGAGGATGCGCCG
CGTTACACGTCGTTTCGCCTCTTTGAACAGCGTGGCGGGATGCTGCGGCGTGAACGGCCGCCCCGGTATT
TTCATACCCGCGTGCTGCGTGGCCCCTCCGGGCGCACGGAAACCTGGTTGATTCCCGGCGGCGAAGCATT
TGAGCGGGAACGTCAGCAGCCTGATGAAGCACTGGTGCTGAGCCTCACTGGCACCAATGGCAGTCTGCCG
CGCAAAACCCTGCAGAGTATCCTTCTCAATCAGCTTGCCGGTACGCCGCAAACCCCGGTTCGCGTGCGTA
ACCTTTGTCGGCCATCGATGCCCTGTTACCCGCCCAACGAAAACCGCTTTCACTGGAAACTGTTAAGTCA
GCTTGGGAGTCGTTTCCTGTGGATGATGAACGATGCAGAGATGCTGCGTAACGCGCTGGCGCTTTATAAC
TGGACAGAGGACGACACAAATCGCCGTCGGTTAAGCGGCATTATTAAAGTTCAGCACCATCGCCTTGAAT
ACTGGAAACGCGGCCTGCAGCGTGGTGTGGATATTGAGGTTACGCTCGACACCACGATGTTCGCCGGAGA
AGGCGATGTCTGGCTGTTTGGCAGCCTGCTGAACCGCTTTTTCGCGCAGTACGCCGATATGCACCTGTTT
AACCGACTCACCCTGATACTACAACCGACAGGACACTGCCTGCGATGGAAAGAAAACCATCAGTCAGCTT
CACGCGGCTGA