SecReT6
Protein ID: 156932369
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_00144
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]131064..132164 [+]
Producthypothetical protein
NoteTssG
UniProt IDA7MMC4
KEGG IDesa:ESA_00144
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.30E-78, Aligned region: 23..326
Protein Sequence: 366 a.a.     [Download]
>gi|156932369|ref|YP_001436285.1| hypothetical protein ESA_00144 [Cronobacter sakazakii ATCC BAA-894]
MERKPSVSFTRLNDAFGTRLPYSSFYRFLQWLEKTHPEYPPLGSSWRISDDPLRLRPYAGMGFPASEFKG
IEPHFDESQDSPPTVRTTFMGLYGITSPLPTAYIDDIAQRRDGHETVEHFLDIFNHRLITQYYRIWRKHS
YPASFEDGGTDRISQCLLGLAGLGIPGTAEHLDTPLSRFLGMLPALQLPGRTAEGIAAVVSMVTPDTSVT
VRPRYQRKVDIPELSLSANGEGFCLDDRPVMGGFAWDMNSTIEIRLYTESKADVRGWMPPGYTLYHDLLS
LLRVYLGWRYDACISLTFPRRLLPAPRLTARDHKDSVYMGYSFLLGHDPDDTGPDPEMPDEVTIKLGRYE
GLKKNPVRREVTEVED
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|156932229|ref|NC_009778.1|:131064-132164 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGAAAGAAAACCATCAGTCAGCTTCACGCGGCTGAATGACGCGTTCGGCACACGCCTGCCGTACAGCA
GCTTTTACCGCTTTCTGCAGTGGCTGGAAAAAACGCACCCGGAATACCCGCCGCTGGGGAGCTCCTGGCG
TATCAGCGATGACCCGCTGCGACTGCGCCCGTATGCCGGGATGGGTTTTCCGGCGAGCGAGTTTAAAGGC
ATCGAACCTCATTTTGATGAGAGCCAGGACTCGCCGCCGACGGTCAGAACCACCTTTATGGGGCTGTACG
GTATTACGTCTCCGTTACCCACAGCCTATATCGATGATATTGCGCAGCGGCGTGACGGCCATGAAACGGT
AGAGCACTTTCTCGATATCTTTAACCACCGCCTGATAACGCAGTATTACCGTATCTGGCGCAAGCACAGT
TACCCGGCGTCGTTTGAGGACGGCGGTACGGACAGGATTTCGCAGTGCCTGCTGGGGCTGGCGGGGCTCG
GTATTCCCGGTACGGCAGAGCATCTGGATACGCCGTTGTCGCGTTTTCTTGGGATGCTCCCGGCTCTGCA
ACTGCCGGGCCGGACCGCAGAAGGGATTGCCGCCGTGGTCAGCATGGTTACGCCGGATACATCGGTGACG
GTGAGACCGCGCTATCAGCGGAAAGTGGATATCCCGGAGCTGAGCCTGAGCGCGAACGGGGAAGGTTTTT
GTCTGGATGACCGTCCGGTGATGGGCGGTTTCGCCTGGGATATGAACAGTACCATTGAAATCCGGCTGTA
TACCGAAAGCAAGGCTGATGTACGGGGCTGGATGCCGCCGGGATACACGCTGTATCACGATTTACTCTCA
CTGCTGCGTGTCTACCTGGGCTGGCGCTATGACGCGTGTATCTCCCTGACGTTTCCGCGCAGGCTGCTGC
CCGCACCGCGCCTGACCGCACGTGACCACAAGGACAGCGTATACATGGGGTACTCGTTCCTGCTGGGGCA
CGACCCTGACGATACGGGGCCGGACCCGGAAATGCCGGACGAAGTGACGATTAAACTCGGCAGATACGAA
GGACTGAAAAAGAACCCCGTTCGCCGCGAGGTAACAGAGGTTGAAGACTGA