SecReT6
Protein ID: 156932370
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_00145
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]132172..132690 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA7MMC5
KEGG IDesa:ESA_00145
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-43, Aligned region: 13..163
LPAM_1 [PF08139], Evalue: 0.0014, Aligned region: 1..18
Protein Sequence: 172 a.a.     [Download]
>gi|156932370|ref|YP_001436286.1| hypothetical protein ESA_00145 [Cronobacter sakazakii ATCC BAA-894]
MMKRLTLLLLLAFMLTGCGLTQRVSDSTTSVAKAIFYKQVKTLHLDLTARAALNPDEDGMPLATDVWVYQ
LKDRQAFEKADYAALQSDADTVLGADLVAEKEVWIRPGTTVSLDMPLDEETQYVALVAQFRSPDARKNDW
RLVLMRDDLDPDKPRTVLLKGHSMTLKSTEDK
 
Nucleotide Sequence: 519 bp     [Download]
>gi|156932229|ref|NC_009778.1|:132172-132690 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGATGAAACGACTTACTCTATTACTGTTACTGGCTTTTATGCTAACGGGCTGCGGTCTGACGCAGCGGG
TCAGCGACAGTACGACTTCAGTGGCAAAAGCCATTTTCTACAAACAGGTCAAAACATTGCATCTTGACCT
TACTGCCCGTGCGGCACTGAACCCTGATGAAGACGGCATGCCACTGGCGACTGACGTATGGGTGTATCAG
CTGAAAGACCGACAGGCGTTTGAGAAAGCGGATTATGCAGCACTGCAGTCCGACGCTGACACTGTACTGG
GCGCTGATCTGGTGGCTGAAAAAGAGGTGTGGATACGACCGGGCACCACCGTATCGCTGGATATGCCGCT
CGATGAAGAGACGCAGTACGTGGCGCTGGTGGCGCAGTTTCGCTCACCGGATGCGCGTAAGAACGACTGG
CGACTGGTGCTGATGCGGGATGATCTTGACCCGGATAAACCGCGCACTGTGCTGCTGAAAGGGCATTCGA
TGACACTGAAATCAACAGAAGATAAATGA