SecReT6
Protein ID: 156934208
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02037
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1970175..1972733 [-]
Producthypothetical protein
NoteTssI
UniProt IDA7MFB4
KEGG IDesa:ESA_02037
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.00E-56, Aligned region: 35..342
DUF2345 [PF10106], Evalue: 3.50E-32, Aligned region: 605..729
T6SS_Vgr [PF13296], Evalue: 5.50E-30, Aligned region: 473..578
Phage_base_V [PF04717], Evalue: 1.90E-14, Aligned region: 373..467
Protein Sequence: 852 a.a.     [Download]
>gi|156934208|ref|YP_001438124.1| hypothetical protein ESA_02037 [Cronobacter sakazakii ATCC BAA-894]
MNTDNGGQPEESLSRYGLVIHNSDITPDVLRFRGREALSEPFFWNIEFTTPQADIRPEQALMKYASLGMQ
SGRTVYGIVTRFEWYSTSEDQSHYSVTLSSRLALLSRTRQCRVFLNQSVPEVVEQVLREHGLEGADFDFR
LEREYPERELITQWRETDLEFIQRLLSEVGIWWRTEMDSLRGLDVTIFADSQLNYHFDVRLPYREPSGLH
DGAQEAVWGVRTWHNAVTGRVQTRDYYYPAATTPLDATVRVRSAAVTTGEHYRYAEPYREQGDDTDPEPE
SESGAFYARIHHERELNHSLRVHLFSNAGALTPGMVLEPQGDVIRALKEGVIITLTTFRASRDSRLHVSV
WGMPYSERYCYRPPEIPRPEIHGTVPARVESRDPKDTYAWLDEAGRYRVKLDMDREGSESGYSYLWVRLA
KLYAGETYGWHTPLLAGTEVSVAFDGGDPDRPYIAHAFHDSAHPDVVNRDNRSRNILRTPAQNELRMEDK
RGEEHIYLTTEYGKTQLGEGQLVDGQDKPRGTGFELRTDEYGVIRVAKGLFISADGQQKAAGEVLDRETA
VKEIDLCLQQIAQLSASADAANALQADIASQSTMFSERLKPLNELIHMQAPDGMAFTSGEHTQLTATKNV
AVGAGGDISVGVMGNMTALAGEKLGLFAHSGPLSLKSGEGPVEVQAQNGGIQLAAEKKLTLTSVSDISFA
GKKRITLIGGGSYLKLEAGKIEYGTPQVYLRKVERTFNASKAAAAMALPDSQRYSTIGDTNLNKRVVSVG
WSYGDKLIKIEKTSRYFVDLNLHVVTEGYLTGDTVKCEVIYTDGNNNNISLILSGQVNEKGEAILRDVLS
SKNPCIYDDLDL
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1972733-1970175 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAACACGGATAATGGGGGCCAGCCAGAAGAGAGTCTGTCACGGTATGGGCTGGTGATCCACAACAGTG
ATATCACACCGGACGTGCTGCGTTTTCGTGGGCGCGAGGCCTTAAGCGAACCGTTTTTCTGGAATATCGA
ATTTACTACCCCGCAGGCCGATATCCGGCCAGAACAGGCGCTGATGAAATACGCGAGCCTTGGGATGCAG
AGCGGCAGAACGGTTTACGGCATCGTCACCCGGTTCGAGTGGTACTCCACCAGTGAGGATCAGTCGCACT
ACAGCGTGACGCTATCTTCAAGACTGGCGCTGCTGTCGCGTACGCGCCAGTGTCGCGTGTTTCTCAACCA
GTCGGTGCCCGAAGTGGTGGAGCAGGTACTGCGCGAGCATGGCCTGGAAGGGGCGGATTTTGATTTCCGG
CTGGAGCGGGAATACCCGGAGCGTGAGCTTATCACCCAGTGGCGCGAGACTGACCTTGAATTTATTCAGC
GGTTGCTGTCAGAAGTGGGGATCTGGTGGCGCACGGAAATGGACAGCCTGCGCGGTCTGGATGTGACGAT
TTTTGCTGACAGCCAGCTCAATTATCATTTTGACGTCCGCCTGCCGTATCGCGAGCCGTCCGGCCTGCAT
GACGGCGCGCAGGAAGCGGTCTGGGGCGTGCGCACCTGGCATAACGCCGTCACCGGCAGGGTGCAGACGC
GCGACTATTATTACCCCGCCGCCACCACGCCGCTGGACGCCACTGTCAGAGTGCGCAGCGCGGCAGTGAC
CACCGGCGAGCATTACCGCTACGCGGAACCGTACCGGGAGCAGGGCGATGACACCGATCCCGAACCGGAA
AGCGAAAGCGGGGCGTTTTACGCGCGGATTCACCATGAGCGTGAGCTGAATCACTCGCTGCGGGTGCATC
TCTTCAGCAACGCCGGCGCGCTCACGCCGGGGATGGTGCTGGAGCCGCAGGGCGACGTCATCCGCGCGCT
GAAAGAAGGGGTGATTATCACGCTCACCACTTTTCGCGCTTCGCGCGATTCGCGCCTGCATGTGTCGGTG
TGGGGGATGCCCTACAGTGAACGCTACTGCTACCGCCCGCCAGAAATCCCGCGCCCGGAAATACACGGCA
CGGTGCCGGCACGGGTGGAAAGCCGGGACCCGAAGGACACGTACGCCTGGCTGGACGAAGCAGGCCGCTA
CCGGGTGAAGCTGGACATGGACCGCGAGGGCAGCGAGAGCGGCTACAGCTATCTGTGGGTACGCCTGGCG
AAGCTGTATGCGGGCGAGACATACGGCTGGCACACGCCGCTACTGGCCGGCACGGAGGTGTCCGTCGCCT
TTGACGGCGGCGACCCGGACCGGCCCTATATCGCGCACGCCTTTCATGATTCGGCGCACCCGGATGTGGT
GAACCGTGACAACCGCAGCCGGAATATCCTGCGCACACCCGCGCAGAACGAACTGCGCATGGAAGATAAA
CGGGGCGAAGAGCACATCTACCTGACCACCGAATACGGCAAAACGCAGCTAGGCGAAGGGCAACTGGTGG
ACGGGCAGGATAAACCGCGCGGTACGGGCTTTGAGCTGCGCACCGATGAATATGGTGTCATTCGCGTGGC
GAAGGGGCTGTTCATCAGCGCCGACGGGCAGCAGAAGGCGGCGGGCGAGGTGCTGGACCGGGAAACGGCG
GTGAAGGAAATCGACCTGTGCCTGCAGCAGATAGCGCAGCTCTCCGCTTCAGCAGACGCCGCGAACGCGC
TGCAGGCAGACATCGCCAGCCAGAGCACGATGTTCAGCGAGCGGCTGAAACCGCTGAACGAACTGATTCA
CATGCAGGCCCCGGATGGTATGGCGTTCACCAGCGGCGAGCACACGCAGCTTACGGCCACGAAAAATGTG
GCGGTGGGTGCGGGTGGCGACATCAGCGTGGGCGTTATGGGCAACATGACTGCACTGGCGGGTGAAAAAC
TGGGGCTGTTCGCCCACAGCGGGCCGCTGAGCCTGAAATCGGGTGAAGGCCCGGTGGAGGTGCAGGCACA
GAACGGCGGCATACAGCTGGCGGCAGAGAAGAAGCTCACCCTTACGTCGGTGAGTGATATTTCCTTTGCA
GGCAAAAAGCGCATCACCTTAATCGGCGGCGGAAGCTATCTGAAGCTGGAAGCCGGGAAAATAGAGTACG
GTACCCCGCAGGTATATCTGAGGAAGGTGGAGAGGACGTTTAATGCTTCTAAAGCCGCAGCCGCAATGGC
GTTACCAGATAGCCAAAGATACTCGACCATTGGCGATACTAATTTGAATAAAAGAGTTGTTTCAGTTGGA
TGGTCTTACGGTGATAAGTTAATAAAAATTGAAAAAACATCTAGATATTTTGTTGATCTGAATTTGCATG
TTGTCACAGAGGGGTATCTAACAGGTGATACAGTAAAGTGCGAGGTTATTTATACGGATGGTAATAACAA
TAATATTAGTCTTATTTTAAGCGGGCAAGTGAATGAAAAAGGGGAAGCCATTTTAAGGGATGTACTAAGT
TCTAAAAATCCATGTATATATGATGATCTCGATTTATAA