SecReT6
Protein ID: 156934209
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02038
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1972737..1973258 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA7MFB5
KEGG IDesa:ESA_02038
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-38, Aligned region: 14..163
Protein Sequence: 173 a.a.     [Download]
>gi|156934209|ref|YP_001438125.1| hypothetical protein ESA_02038 [Cronobacter sakazakii ATCC BAA-894]
MPNKGWHAITLALCCVMTGCGLTQAVKDGTVSMAKSVFYKKIKTLHLDFSARAALNVDGDQTPLATMVRV
YQLKDRKTLDAADYGSLLQNADTVLKDDLLASRELLIIPKGNVTLDMPMEENAQFVAVVGLFNHPDVKDN
RWRLVLSREDLDPDKPGVVELGDGWLNLVETKE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1973258-1972737 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGCCAAACAAAGGATGGCATGCGATAACGCTCGCGCTGTGCTGCGTCATGACGGGTTGTGGTCTTACCC
AGGCGGTGAAAGACGGGACGGTCAGTATGGCGAAATCGGTGTTTTATAAAAAGATCAAAACATTACATCT
CGATTTTTCTGCCCGAGCGGCGCTTAACGTGGATGGCGACCAGACGCCGCTTGCGACCATGGTCAGGGTC
TATCAGCTTAAAGATCGTAAAACTCTCGATGCGGCTGATTACGGCTCGTTATTGCAGAATGCGGACACCG
TGCTGAAAGACGATCTGCTGGCTTCCCGCGAGTTGCTCATCATCCCGAAGGGCAATGTCACGCTTGATAT
GCCGATGGAAGAAAACGCACAGTTTGTAGCGGTAGTGGGGCTGTTTAACCATCCTGACGTCAAAGACAAC
CGCTGGCGACTGGTGCTTTCCAGGGAGGATCTTGACCCGGATAAACCAGGAGTGGTGGAGCTGGGTGACG
GCTGGCTCAATCTGGTGGAGACAAAGGAGTGA