SecReT6
Protein ID: 156934210
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02039
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1973284..1974366 [-]
Producthypothetical protein
NoteTssG
UniProt IDA7MFB6
KEGG IDesa:ESA_02039
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-84, Aligned region: 18..321
Protein Sequence: 360 a.a.     [Download]
>gi|156934210|ref|YP_001438126.1| hypothetical protein ESA_02039 [Cronobacter sakazakii ATCC BAA-894]
MAREPQPAHTGLTQQLGEEIWRVNFYRFCQLLEQEHPDHPLLGSTSYPENDSVRFRSWPGMGFPASELRR
VETDDEHPGSPPAVRTTFLGMYGVDSPLPGNYLDDIAQRREGQEAVSSFLDIFGHRIATQYYRIWRKYAY
PATFEPGGTDATSQCLLGLVGLGIPGTAEHIATPVSRFLALLGAMRLPTRNAEGIRALVTLLAPDTRAEI
SERDPVKVRVTNRSGLGGGERVRLAQRATLGKMARDANSRVLITLFTRNPQEAAGWLPGGQLHTDLLALM
RVYLGYRSDARLRLTVPVHLLPEPKLAKHRRIQLGRTGLLGLKGGKLSDNRQCITVSLGCYESLSCTVLP
LAAEGSYRFD
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1974366-1973284 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGCGCGAGAACCACAGCCAGCACATACCGGGCTGACGCAGCAATTAGGCGAGGAGATCTGGCGCGTTA
ATTTCTATCGCTTCTGCCAGTTGCTTGAGCAGGAACATCCTGACCATCCGCTCCTGGGAAGCACCAGCTA
CCCTGAAAATGATTCGGTGCGGTTTCGCTCCTGGCCGGGCATGGGATTTCCGGCCAGTGAATTACGCCGC
GTGGAAACGGATGACGAACACCCCGGCTCCCCGCCCGCGGTACGCACTACGTTTCTCGGCATGTACGGCG
TCGACTCGCCGCTACCGGGCAACTATCTGGATGATATCGCTCAGCGGCGCGAAGGGCAGGAAGCCGTATC
CTCGTTTCTGGATATCTTCGGCCACCGTATCGCCACACAGTATTACCGCATCTGGCGGAAATATGCGTAC
CCGGCCACGTTTGAGCCCGGCGGGACAGATGCCACTTCTCAATGCCTGCTTGGGCTGGTCGGACTTGGCA
TTCCCGGCACGGCAGAACATATCGCTACCCCCGTTTCGCGTTTTCTCGCGCTGCTCGGCGCCATGCGCTT
ACCGACGCGAAATGCTGAGGGAATACGCGCGCTGGTGACTCTGCTGGCACCAGACACACGGGCAGAGATC
TCTGAGCGCGATCCTGTAAAAGTGCGGGTGACAAACCGCAGCGGGCTGGGGGGAGGCGAACGAGTACGTT
TAGCGCAGCGTGCGACACTCGGAAAAATGGCGCGTGATGCAAACAGTCGGGTGCTCATTACATTATTCAC
CCGCAATCCGCAGGAGGCTGCAGGCTGGCTGCCGGGCGGGCAATTGCATACTGATTTGCTGGCGCTGATG
CGGGTTTATCTCGGCTATCGCAGTGACGCACGGCTTCGCCTGACAGTGCCGGTACATTTACTCCCTGAAC
CAAAGCTTGCGAAACATCGGCGCATTCAGCTTGGCCGCACAGGCCTGCTGGGTTTGAAAGGCGGCAAACT
CAGCGATAACCGCCAGTGCATCACGGTCAGCCTGGGATGTTATGAAAGCCTGAGTTGCACGGTATTGCCG
CTTGCCGCAGAGGGCAGTTACCGCTTCGACTAA