SecReT6
Protein ID: 156934211
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02040
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1974330..1976099 [-]
Producthypothetical protein
NoteTssF
UniProt IDA7MFB7
KEGG IDesa:ESA_02040
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.00E-187, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|156934211|ref|YP_001438127.1| hypothetical protein ESA_02040 [Cronobacter sakazakii ATCC BAA-894]
MDDLTLRYYEAEMRYLREAGKEFSRAHPDRAAMLNLDKPGAHDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLSIVEFSPDWRGLRQSESLPEGFSVLSRPVGPQKTACQYRTTREITLQPIS
LTEARLHTEPDGRSAIRLRFACSQKVDWAKSGIDKVAIFLNAESPVSSALHLALTRRVHAMYARHSTTHA
ERLRFDGWFRPMGFDDTDRLWPKGDSAFSGYQLLLEYFSFRQKFMFVELCGLESIGLTAESDWFEIDIVL
TEGWPADLPFETENFRLHCAPVINLFTLEADPLTLNPLENEYLLRPLRLQDGHTEIYSVDDIHGAVKNGK
HPYVPFTSFRHRGGMMRFDAPERYFHTRVKRGPSGLHDTWLILGGRSFEIEQLAEKPESLSMRITGTNGQ
LPRKALQSTLIDRVVKIGKVPVSVINLTAPTMPLYPPASDRFHWRVMSHLGSNFLSMMDNPEVLRGTLAL
YDWTDDEMNRRRLDAIVAVKHTLIRRFEQGFMQRGVDIEVTLDTQHFAGEGDVNLFGEMLHRFFALYADI
HLFNQLTLVLQPTGKRLRWRENHSQHIPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1976099-1974330 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGGATGATTTAACACTGCGCTACTACGAGGCAGAAATGCGCTATCTGCGCGAAGCCGGAAAGGAGTTTT
CCCGCGCGCACCCTGACCGTGCAGCGATGCTCAATCTGGACAAGCCCGGCGCCCACGATCCTTACGTCGA
ACGCCTGTTTGAAGGGTTTGCGTTTTTGATGGGGCGGCTTCGTGAAAAGCTTGATGACGATCTCCCCGAA
CTCACGGAAGGGCTGGTCAGCCTGTTGTGGCCGCACTATATGCGTACCATTCCGTCGCTGTCGATCGTGG
AGTTTTCGCCCGACTGGCGCGGGCTCAGGCAGTCGGAATCCTTACCGGAAGGCTTTTCCGTTTTATCTCG
TCCGGTCGGCCCCCAGAAAACGGCCTGCCAGTATCGCACTACCCGCGAGATAACGCTGCAACCGATTAGT
CTCACTGAGGCTCGCCTTCACACTGAACCTGACGGGCGTTCTGCCATTCGTCTGCGTTTTGCATGCAGCC
AAAAAGTGGACTGGGCGAAATCCGGCATCGATAAAGTCGCCATTTTTCTTAACGCGGAAAGCCCGGTGAG
TTCTGCGCTTCATCTGGCATTAACTCGCCGTGTGCATGCCATGTATGCGCGCCACAGCACAACCCATGCT
GAACGCCTGCGCTTTGACGGCTGGTTTCGCCCGATGGGTTTTGATGATACGGACCGGCTGTGGCCGAAAG
GCGACTCCGCGTTCAGTGGCTATCAGTTACTGCTGGAGTATTTCAGCTTCCGGCAGAAGTTTATGTTTGT
CGAGTTGTGTGGGCTGGAATCCATTGGACTCACTGCCGAAAGTGACTGGTTTGAAATCGATATTGTCCTC
ACAGAAGGATGGCCTGCCGATCTGCCGTTTGAAACCGAAAACTTTCGTCTGCACTGCGCGCCGGTAATCA
ACCTTTTCACGCTGGAAGCTGACCCGCTGACGCTCAATCCTCTGGAAAACGAGTACCTGTTGCGGCCGCT
GCGTCTTCAGGACGGCCATACGGAAATTTACAGCGTTGATGACATTCACGGCGCTGTGAAAAACGGTAAG
CATCCTTATGTGCCCTTTACCAGTTTTCGCCACCGGGGCGGCATGATGCGGTTCGATGCGCCAGAGCGCT
ACTTCCATACCCGTGTGAAGCGCGGCCCGTCTGGCCTGCACGATACCTGGCTGATTCTTGGTGGCCGCTC
GTTTGAAATAGAACAACTGGCGGAAAAACCGGAATCGCTCTCAATGCGTATCACCGGCACCAATGGCCAG
CTTCCCCGCAAAGCGTTGCAAAGCACGCTGATTGACCGGGTAGTGAAAATTGGCAAAGTGCCGGTCAGCG
TGATTAACCTCACGGCACCCACGATGCCGTTGTATCCCCCTGCGAGCGATCGTTTTCACTGGCGCGTAAT
GAGTCACCTGGGGTCGAACTTTCTCAGCATGATGGACAACCCCGAGGTGTTGCGCGGCACGCTGGCGCTC
TACGACTGGACCGACGATGAGATGAATCGCCGACGTCTTGACGCAATCGTCGCGGTGAAACACACCCTTA
TACGTCGCTTTGAACAGGGGTTTATGCAAAGAGGGGTGGATATCGAAGTGACTCTGGACACACAACATTT
TGCCGGTGAGGGCGATGTGAATCTGTTTGGTGAAATGCTGCATCGCTTCTTTGCACTTTACGCGGATATT
CATCTTTTTAATCAGCTCACGCTGGTATTGCAACCGACAGGGAAGAGACTGAGATGGCGCGAGAACCACA
GCCAGCACATACCGGGCTGA