SecReT6
Protein ID: 156934213
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02042
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1977629..1978411 [-]
Producthypothetical protein
NoteTssC
UniProt IDA7MFA1
KEGG IDesa:ESA_02042
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-65, Aligned region: 88..256
DUF3508 [PF12018], Evalue: 0.0012, Aligned region: 63..143
Protein Sequence: 260 a.a.     [Download]
>gi|156934213|ref|YP_001438129.1| hypothetical protein ESA_02042 [Cronobacter sakazakii ATCC BAA-894]
MLMSVQNTPTAAGATQVPETTGGVYASLFEKINLHPVDALDDIDAWQDSQRLADASADERVTAAVRVFLE
RLKQSGQQVEKLDKTLLDHHIAELDRQISRQLDTVMHHPEFQQVESLWRGLKHLVDRTDYRQNVRTEILD
IAKEDLRQDFEDAPEIIQSGLYWHTYTAEYDTPGGEPVGAVISSYEFDASAQDMALLRNISKVSAAAHMP
FIGAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDDRALLY
 
Nucleotide Sequence: 783 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1978411-1977629 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGCTGATGTCTGTTCAGAACACCCCCACTGCTGCCGGCGCCACGCAGGTACCGGAAACCACCGGCGGCG
TCTACGCCTCGCTGTTTGAAAAAATTAACCTTCACCCGGTCGACGCGCTTGATGATATCGACGCCTGGCA
GGACAGCCAGCGCCTGGCGGACGCCTCCGCCGATGAGCGCGTGACCGCCGCGGTCCGGGTTTTCCTGGAG
CGCCTGAAACAGTCCGGCCAGCAGGTTGAAAAGCTCGACAAAACGCTGCTTGACCACCATATCGCTGAGC
TGGACCGGCAAATCAGCCGCCAGCTGGATACGGTGATGCACCACCCGGAGTTTCAGCAGGTGGAATCGCT
GTGGCGCGGCCTGAAGCATCTGGTGGACCGCACCGACTACCGCCAGAACGTGCGCACGGAAATTCTCGAT
ATCGCCAAAGAGGATTTGCGCCAGGACTTCGAGGACGCGCCGGAAATTATCCAGAGCGGCCTCTACTGGC
ACACCTACACGGCGGAATATGACACGCCCGGCGGTGAGCCGGTGGGGGCGGTGATTTCCTCGTATGAGTT
TGACGCCAGTGCGCAGGATATGGCGCTGCTGCGTAACATCTCTAAAGTCTCCGCCGCGGCGCACATGCCG
TTTATCGGTGCCGTCGGCCCGAAATTTTTCCTCAAAGATTCCATGGAAGAGGTGGCGGCGATTAAGGACA
TCGGCAACTACTTTGACCGCGCCGAATACATCAAGTGGAAATCCTTCCGTGACACCGACGATGACCGCGC
GTTACTTTACTGA