SecReT6
Protein ID: 156934214
SecReT6 ID226
T6SS typei2
Gene symbol-
Locus tagESA_02043
StrainCronobacter sakazakii ATCC BAA-894
Repliconchromosome [GenBank: NC_009778] [Browse all T6SS(s) in this replicon]
Location [Strand]1978446..1978958 [-]
Producthypothetical protein
NoteTssB
UniProt IDA7MFA2
KEGG IDesa:ESA_02043
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.70E-53, Aligned region: 11..163
Protein Sequence: 170 a.a.     [Download]
>gi|156934214|ref|YP_001438130.1| hypothetical protein ESA_02043 [Cronobacter sakazakii ATCC BAA-894]
MKEHVMSGSFQEELPKARINLKLNLHTGGAQKKIELPLKLLVTGDFSHGQEHRPLSERKKIDINKNNFDS
VLSEFSPALNLAVENTLAGDGREENVRLTFRQMKDFEPEQVARQIPQLKAMLAMRNLLRDLKSNLLDNAT
FRRELETILKDPALSDGLRAELASLAPKHA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|156932229|ref|NC_009778.1|:c1978958-1978446 Cronobacter sakazakii ATCC BAA-894 chromosome, complete genome
ATGAAGGAACACGTCATGTCTGGTTCATTTCAGGAAGAACTTCCTAAAGCCCGTATTAACCTGAAGTTAA
ATCTGCACACCGGTGGCGCGCAGAAAAAAATCGAGCTGCCGCTGAAATTACTGGTCACCGGCGATTTCAG
TCACGGCCAGGAGCACCGGCCGCTGTCTGAGCGCAAAAAAATCGACATAAACAAAAATAATTTCGACAGC
GTGCTTTCGGAATTTTCACCGGCGCTGAATCTCGCCGTGGAAAATACCCTGGCCGGTGACGGGCGCGAAG
AAAACGTGCGCCTGACCTTCCGCCAGATGAAAGATTTCGAGCCGGAGCAGGTGGCGCGGCAAATTCCCCA
GCTGAAAGCCATGCTCGCGATGCGCAATTTACTGCGCGACCTGAAATCCAATCTCCTTGATAACGCCACC
TTCCGCAGGGAGCTGGAAACCATCCTGAAGGATCCGGCCCTGAGCGATGGCTTACGCGCGGAACTGGCGT
CGCTGGCCCCGAAACACGCCTGA