SecReT6
Protein ID: 156936600
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05481
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]43387..43995 [+]
Producthypothetical protein
NoteTssD
UniProt IDA7MRP5
KEGG IDesa:ESA_pESA3p05481
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.20E-35, Aligned region: 48..177
Candida_ALS [PF05792], Evalue: 0.0089, Aligned region: 144..164
Protein Sequence: 202 a.a.     [Download]
>gi|156936600|ref|YP_001440514.1| hypothetical protein ESA_pESA3p05481 [Cronobacter sakazakii ATCC BAA-894]
MRFVLISGAVLFSVLNELTVKPNYLPPGFAYSHLLSDNTEYYMAIDMFLKVEGVTGESKDANHASWIDVL
SFNWGAAQPGNMAVGGGGGAGKVNFQDLAVQAIVDKGTPAILKFCASGKHVNKVELSVCKAGGQQVEYSK
IVLEDVLVTRTEFTGVGQTDTVLVSYYFQAAKVNFHYWEQSNQGTKGAETKAGWDIKQNKEL
 
Nucleotide Sequence: 609 bp     [Download]
>gi|156936546|ref|NC_009780.1|:43387-43995 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGAGATTCGTCTTAATTTCCGGAGCGGTATTGTTTAGCGTTTTGAATGAACTTACAGTGAAACCGAATT
ATTTGCCTCCGGGCTTTGCTTATTCTCACCTGCTATCTGATAACACGGAGTATTACATGGCTATTGATAT
GTTCCTGAAAGTGGAAGGCGTGACCGGCGAATCTAAAGATGCTAATCATGCCAGCTGGATCGATGTCCTT
TCTTTTAACTGGGGCGCAGCGCAGCCGGGCAATATGGCGGTCGGCGGTGGCGGCGGTGCCGGTAAAGTTA
ACTTTCAGGATTTAGCCGTACAGGCCATTGTGGATAAAGGCACGCCCGCCATTCTTAAATTCTGCGCCAG
CGGTAAACATGTCAATAAGGTGGAGCTTTCTGTCTGTAAGGCCGGTGGTCAGCAGGTAGAATATTCAAAA
ATCGTTCTTGAAGATGTGCTGGTGACCCGCACGGAATTCACGGGCGTGGGGCAGACAGATACGGTTCTTG
TCAGTTACTACTTCCAGGCCGCGAAGGTGAATTTCCATTACTGGGAACAGTCGAACCAGGGTACCAAAGG
TGCGGAAACCAAAGCCGGTTGGGATATTAAACAAAATAAAGAGCTCTGA