SecReT6
Protein ID: 156936610
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05491
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]53314..53811 [+]
Producthypothetical protein
NoteTssB
UniProt IDA7MRG6
KEGG IDesa:ESA_pESA3p05491
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.30E-54, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|156936610|ref|YP_001440524.1| hypothetical protein ESA_pESA3p05491 [Cronobacter sakazakii ATCC BAA-894]
MSGSFQEEIPKARINLKLNLHTGGAQKKVELPLKLLVTGDFSHGQEHRPLSERKKIDINKNNFDSVLSEF
SPALNLAVENTLTGDGCEENVRLTFRQMKDFEPEQVARQIPQLKAMLAMRNLLRDLKSNLLDNATFRREL
ETILKDPALSDGLRAELASLAPKHA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|156936546|ref|NC_009780.1|:53314-53811 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGTCTGGTTCATTTCAGGAAGAAATTCCTAAAGCCCGTATTAACCTGAAGTTAAATCTGCACACCGGCG
GCGCGCAGAAAAAAGTTGAGCTGCCGCTGAAATTACTGGTCACCGGCGATTTCAGTCACGGCCAGGAGCA
CCGGCCGCTGTCTGAGCGCAAAAAAATCGACATAAACAAAAATAATTTCGACAGCGTGCTTTCGGAATTT
TCACCGGCGCTGAATCTCGCCGTGGAAAATACCCTGACCGGTGACGGGTGCGAAGAAAACGTGCGCCTGA
CCTTCCGCCAGATGAAAGATTTCGAGCCGGAGCAGGTGGCGCGGCAAATTCCCCAGCTGAAAGCCATGCT
CGCGATGCGCAATTTACTGCGCGACCTGAAATCCAATCTCCTTGATAACGCCACCTTCCGCAGGGAGCTG
GAAACCATCCTGAAGGATCCGGCGCTGAGCGATGGCTTACGCGCGGAACTGGCGTCGCTGGCCCCGAAAC
ACGCCTGA