SecReT6
Protein ID: 156936611
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05492
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]53846..55387 [+]
Producthypothetical protein
NoteTssC
UniProt IDA7MRF1
KEGG IDesa:ESA_pESA3p05492
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.50E-174, Aligned region: 88..509
DUF3508 [PF12018], Evalue: 0.0026, Aligned region: 63..142
Protein Sequence: 513 a.a.     [Download]
>gi|156936611|ref|YP_001440525.1| hypothetical protein ESA_pESA3p05492 [Cronobacter sakazakii ATCC BAA-894]
MLMSVQNTPTAAGATQVQETTGGVYASLFEKINLHPVDALDDIDAWQDSQRLADASADERVTAAVRVFLE
RLKQSGQQVEKLDKTLLDHHIAELDRQISRQLDTVMHHPEFQQVESLWRGLKHLVNRTDYRQNVRTEILD
IAKEDLRQDFEDAPEIIQSGLYWHTYTAEYDTPGGEPVGAVISSYEFDASAQDMALLRNISKVSAAAHMP
FIGAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLTLPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHEKYLWTSASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTPDATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVRLYAV
PHFQVEGMDVSLSLVSQMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|156936546|ref|NC_009780.1|:53846-55387 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGCTGATGTCTGTTCAGAACACCCCCACTGCTGCCGGCGCCACGCAGGTGCAGGAAACCACCGGCGGCG
TTTACGCCTCGCTGTTTGAAAAAATTAACCTTCATCCGGTCGACGCGCTTGATGATATCGACGCCTGGCA
GGACAGCCAGCGCCTGGCGGACGCCTCCGCCGATGAGCGCGTGACCGCCGCGGTCCGGGTTTTCCTGGAG
CGCCTGAAACAGTCCGGCCAGCAGGTTGAAAAGCTCGACAAAACGCTGCTTGACCACCATATCGCTGAGC
TGGACCGGCAAATCAGCCGCCAGCTGGATACGGTGATGCACCATCCGGAGTTTCAGCAGGTGGAATCGCT
GTGGCGCGGCCTGAAGCATCTGGTGAACCGCACCGACTACCGCCAGAACGTGCGCACGGAAATTCTCGAT
ATCGCCAAAGAGGATTTGCGCCAGGACTTCGAGGACGCGCCGGAAATCATCCAGAGCGGCCTCTACTGGC
ACACCTACACGGCGGAATATGACACGCCCGGCGGTGAGCCGGTGGGCGCGGTGATTTCCTCGTATGAGTT
TGACGCCAGTGCGCAGGATATGGCGCTGCTGCGTAATATTTCTAAAGTCTCCGCCGCGGCGCACATGCCG
TTTATCGGTGCCGTTGGCCCGAAATTTTTCCTCAAAGATTCCATGGAAGAGGTGGCGGCGATTAAGGATA
TCGGCAACTACTTTGACCGCGCCGAATACATCAAGTGGAAATCCTTCCGCGACACCGACGATGCCCGCTA
TATCGGCCTGACCCTGCCGCGCGTGCTGGGCCGCCTGCCGTACGGCCCGGACACCGTGCCGGTGCGCAGC
TTTAACTATGTGGAAGAGGTGAAAGGGCCGGACCACGAAAAATACCTGTGGACCAGCGCGTCGTTTGCCT
TCGCGGCCAATATGGTGAAGAGCTTCATTAATAACGGCTGGTGCGTGCAGATCCGCGGCCCGCAGGCGGG
CGGCGCGGTGCAGGACCTGCCGATTCATCTCTATGACCTCGGCACCGGCAATCAGGTGAAAATCCCGTCG
GAAGTGATGATCCCGGAGACGCGTGAATTTGAGTTCGCGAACCTCGGTTTTATCCCGCTCTCCTACTACA
AAAACCGCGACTACGCCTGCTTCTTCTCGGCGAACTCGGCGCAGAAACCGGCGCTGTACGACACGCCGGA
CGCCACCGCCAACAGCCGCATCAACGCGCGCCTGCCGTACATTTTCCTGCTGTCGCGCATCGCGCACTAC
CTGAAGCTGATTCAGCGCGAGAACATCGGCACCACCAAAGACCGCCGTCTGCTGGAGCTGGAGCTGAACA
ACTGGGTGCGCGGTCTGGTGACGGAGATGACTGACCCGGGCGACGAGCTGCAGGCGTCGCACCCGCTGCG
CGACGCGAAAGTGGTGGTGGAAGATATCGAAGACAACCCGGGCTTTTTCCGCGTCAGGCTGTACGCCGTG
CCGCATTTCCAGGTGGAAGGCATGGACGTCAGCCTGTCGCTGGTGTCGCAGATGCCGAAAGCGAAGTCAT
AA