SecReT6
Protein ID: 156936612
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05493
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]55398..56738 [+]
Producthypothetical protein
NoteTssK
UniProt IDA7MRF2
KEGG IDesa:ESA_pESA3p05493
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.30E-129, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|156936612|ref|YP_001440526.1| hypothetical protein ESA_pESA3p05493 [Cronobacter sakazakii ATCC BAA-894]
MKIYRPLWEDGAFLAPQQFQQQARWDAWVADTVARMTLANPWGVLCAEFDEGALTLARLNATRLVVRFAD
GTLIDTDLADNLPPVCDLSGLEQESVDVLLCLPLLSANGGNLENRQDSARPRRWQSERVTVQELAGHERS
ELAVLRHALTLRLSGQDNGAYLTCPVARLQRNLQGQWVMDKRFIPPMLSLAASPVLCGELHDLLHRLQAR
RKRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLSELYQFPSRHPEILYRELVRLTGSLLTFSLE
HHAEEIPAYQHEQPEQVFPPLFALLDTLLEASLPSRVIAVALEQGPDCEIWRGKLHDARLREGADFYLSV
RSALPNHELQTRFPQLCKAGSHDDVSEVVNIALSGMVIKPLSHVPAAIPLRLENQYFALDLTTDAARAML
DAGNCAFYTPQSLGEVKLELFAVLRS
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|156936546|ref|NC_009780.1|:55398-56738 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGAAAATCTATCGCCCGTTATGGGAAGACGGGGCCTTTCTGGCCCCGCAGCAATTTCAGCAACAAGCCC
GCTGGGACGCCTGGGTCGCGGATACGGTTGCCAGAATGACCCTGGCGAACCCGTGGGGAGTGCTTTGCGC
AGAATTTGACGAAGGCGCGTTAACGCTCGCCAGACTCAATGCGACGCGCCTGGTGGTACGCTTTGCCGAC
GGAACGCTGATTGACACCGATCTTGCCGATAATTTACCGCCAGTATGCGATTTATCCGGGCTGGAACAGG
AAAGTGTCGACGTTTTACTTTGCCTGCCGCTCCTCAGTGCAAATGGCGGCAATCTGGAGAATAGACAGGA
CAGCGCCCGTCCGCGACGCTGGCAGTCTGAACGGGTAACCGTTCAGGAGCTGGCGGGACATGAGCGTAGC
GAGCTGGCTGTTCTGCGCCACGCACTGACGCTTCGCCTCTCAGGTCAGGATAACGGCGCCTATCTCACCT
GCCCGGTGGCGCGATTACAGCGCAATCTGCAAGGGCAGTGGGTAATGGATAAGCGTTTCATCCCGCCGAT
GCTATCGCTGGCGGCAAGCCCTGTGCTGTGCGGCGAACTCCACGATCTTTTACACCGCCTGCAGGCCAGG
CGGAAACGTCTGATGGCGATGCGGCGGGAAAGTAATGAGCGTATGGCTGATTTCGCCGTGGCGGACGTTT
CTTTGTTCTGGCTGTTAAATGCCCTGAACAGCGCAGAGCCCGTTTTAAGTGAGCTCTATCAGTTTCCCTC
GCGTCACCCTGAAATCCTCTACCGTGAGCTGGTAAGACTGACTGGCAGCCTGCTGACCTTTTCGCTTGAA
CATCACGCGGAGGAAATCCCGGCGTATCAGCATGAGCAGCCGGAACAGGTATTTCCGCCGCTTTTTGCTC
TGCTGGATACGTTACTGGAAGCGAGCCTGCCCTCACGTGTCATTGCTGTCGCGCTGGAACAGGGGCCGGA
CTGTGAGATCTGGCGAGGGAAGTTACACGATGCGCGGCTGCGCGAAGGGGCGGATTTCTATCTTTCGGTG
CGTTCAGCGCTGCCGAATCACGAACTCCAGACACGTTTTCCGCAATTGTGCAAAGCGGGCAGCCATGACG
ACGTTTCAGAGGTCGTCAATATCGCGCTCAGCGGTATGGTAATCAAACCGCTCAGTCATGTTCCTGCAGC
GATTCCGCTGCGTCTTGAGAATCAGTATTTCGCGCTGGATCTGACCACCGATGCCGCCCGCGCCATGCTC
GACGCCGGGAACTGCGCCTTCTACACGCCGCAGTCTCTCGGTGAGGTAAAACTGGAACTGTTTGCGGTGC
TGCGGTCATGA