SecReT6
Protein ID: 156936613
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05494
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]56735..57388 [+]
Producthypothetical protein
NoteTssL
UniProt IDA7MRF3
KEGG IDesa:ESA_pESA3p05494
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.30E-44, Aligned region: 9..205
Protein Sequence: 217 a.a.     [Download]
>gi|156936613|ref|YP_001440527.1| hypothetical protein ESA_pESA3p05494 [Cronobacter sakazakii ATCC BAA-894]
MKKDEINLINRVFYPGWLMVSQLRSGQAINDGEALYRRACQWITTARQTLTDAGFSEASCETMVYAYCAL
IDESVMNRDRQDDGYRKWRQDPLQARFFSTLNAGEELWERIRIALRDPAPDSAVLTCLYRTLQLGFVGLY
RAQDDERREDVVRALSEYVPPFELTQGESVVVSASRLRSGRRFYWLGWIAGIVTLAALWLAFSAALTRQV
AQIAGQG
 
Nucleotide Sequence: 654 bp     [Download]
>gi|156936546|ref|NC_009780.1|:56735-57388 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGAAAAAAGATGAAATAAACCTCATAAACAGGGTGTTTTATCCTGGCTGGCTGATGGTCAGCCAGTTAC
GCAGCGGGCAGGCGATCAACGATGGTGAAGCGCTTTATCGCCGCGCCTGCCAGTGGATCACTACAGCACG
CCAGACGCTGACTGACGCAGGTTTCAGCGAGGCGAGTTGTGAAACGATGGTGTATGCGTACTGCGCGCTG
ATCGATGAAAGCGTGATGAACCGTGACAGGCAGGACGACGGGTATCGTAAATGGCGCCAGGATCCGTTAC
AGGCGCGTTTTTTCAGCACGCTGAATGCAGGTGAAGAGCTGTGGGAACGCATCCGCATTGCCCTTCGCGA
TCCTGCGCCGGACAGTGCCGTGCTGACCTGTCTGTATCGCACTCTGCAGCTGGGTTTTGTCGGCCTGTAC
CGCGCGCAGGATGACGAGCGGCGCGAAGATGTGGTACGCGCACTGAGTGAATATGTCCCTCCGTTTGAGC
TGACGCAGGGGGAATCTGTTGTAGTCAGCGCCTCCCGCCTGCGAAGCGGACGTCGTTTCTACTGGCTGGG
GTGGATCGCGGGGATAGTGACGCTGGCGGCGCTGTGGCTTGCGTTTTCCGCTGCGCTGACGCGCCAGGTT
GCGCAAATAGCAGGGCAGGGATGA