SecReT6
Protein ID: 156936616
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05497
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]59747..62413 [+]
Producthypothetical protein
NoteTssH
UniProt IDA7MRF6
KEGG IDesa:ESA_pESA3p05497
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.00E-41, Aligned region: 245..264
AAA_2 [PF07724], Evalue: 7.00E-41, Aligned region: 619..784
AAA [PF00004], Evalue: 7.00E-21, Aligned region: 247..359
AAA [PF00004], Evalue: 7.00E-21, Aligned region: 624..747
AAA [PF00004], Evalue: 7.00E-21, Aligned region: 772..789
AAA_16 [PF13191], Evalue: 1.80E-15, Aligned region: 144..204
AAA_16 [PF13191], Evalue: 1.80E-15, Aligned region: 224..269
AAA_16 [PF13191], Evalue: 1.80E-15, Aligned region: 292..325
AAA_16 [PF13191], Evalue: 1.80E-15, Aligned region: 593..660
AAA_16 [PF13191], Evalue: 1.80E-15, Aligned region: 687..717
AAA_16 [PF13191], Evalue: 1.80E-15, Aligned region: 762..808
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 247..269
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 446..504
AAA_5 [PF07728], Evalue: 1.10E-13, Aligned region: 623..742
ClpB_D2-small [PF10431], Evalue: 1.60E-13, Aligned region: 392..416
ClpB_D2-small [PF10431], Evalue: 1.60E-13, Aligned region: 584..608
ClpB_D2-small [PF10431], Evalue: 1.60E-13, Aligned region: 790..859
AAA_22 [PF13401], Evalue: 2.20E-10, Aligned region: 246..332
AAA_22 [PF13401], Evalue: 2.20E-10, Aligned region: 620..665
AAA_22 [PF13401], Evalue: 2.20E-10, Aligned region: 791..816
AAA_19 [PF13245], Evalue: 2.00E-09, Aligned region: 244..280
AAA_19 [PF13245], Evalue: 2.00E-09, Aligned region: 619..646
AAA_25 [PF13481], Evalue: 7.30E-09, Aligned region: 247..271
AAA_25 [PF13481], Evalue: 7.30E-09, Aligned region: 300..335
AAA_25 [PF13481], Evalue: 7.30E-09, Aligned region: 619..652
AAA_17 [PF13207], Evalue: 2.30E-07, Aligned region: 247..349
AAA_17 [PF13207], Evalue: 2.30E-07, Aligned region: 622..659
AAA_17 [PF13207], Evalue: 2.30E-07, Aligned region: 805..828
Arch_ATPase [PF01637], Evalue: 2.60E-07, Aligned region: 225..262
Arch_ATPase [PF01637], Evalue: 2.60E-07, Aligned region: 299..397
Arch_ATPase [PF01637], Evalue: 2.60E-07, Aligned region: 616..661
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 241..308
IstB_IS21 [PF01695], Evalue: 1.10E-06, Aligned region: 623..642
AAA_14 [PF13173], Evalue: 2.90E-06, Aligned region: 247..344
AAA_14 [PF13173], Evalue: 2.90E-06, Aligned region: 621..705
NACHT [PF05729], Evalue: 4.50E-06, Aligned region: 247..277
NACHT [PF05729], Evalue: 4.50E-06, Aligned region: 623..648
Sigma54_activat [PF00158], Evalue: 8.70E-06, Aligned region: 230..261
Sigma54_activat [PF00158], Evalue: 8.70E-06, Aligned region: 622..740
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 241..271
Zeta_toxin [PF06414], Evalue: 2.30E-05, Aligned region: 619..663
AAA_18 [PF13238], Evalue: 0.00031, Aligned region: 247..267
AAA_18 [PF13238], Evalue: 0.00031, Aligned region: 624..650
AAA_29 [PF13555], Evalue: 0.00046, Aligned region: 241..263
AAA_29 [PF13555], Evalue: 0.00046, Aligned region: 619..648
T2SE [PF00437], Evalue: 0.00057, Aligned region: 219..266
T2SE [PF00437], Evalue: 0.00057, Aligned region: 603..701
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 247..287
AAA_28 [PF13521], Evalue: 0.0011, Aligned region: 623..643
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 248..269
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 624..645
RNA_helicase [PF00910], Evalue: 0.0014, Aligned region: 721..742
DUF815 [PF05673], Evalue: 0.0028, Aligned region: 238..322
DUF815 [PF05673], Evalue: 0.0028, Aligned region: 622..660
AAA_23 [PF13476], Evalue: 0.0041, Aligned region: 247..264
AAA_23 [PF13476], Evalue: 0.0041, Aligned region: 483..539
AAA_23 [PF13476], Evalue: 0.0041, Aligned region: 620..646
DUF2075 [PF09848], Evalue: 0.0056, Aligned region: 249..349
DUF2075 [PF09848], Evalue: 0.0056, Aligned region: 622..646
Clp_N [PF02861], Evalue: 0.0077, Aligned region: 25..68
Clp_N [PF02861], Evalue: 0.0077, Aligned region: 111..123
AAA_30 [PF13604], Evalue: 0.0077, Aligned region: 244..269
AAA_30 [PF13604], Evalue: 0.0077, Aligned region: 620..651
Protein Sequence: 888 a.a.     [Download]
>gi|156936616|ref|YP_001440530.1| hypothetical protein ESA_pESA3p05497 [Cronobacter sakazakii ATCC BAA-894]
MSMEHQSAVLLRRLNPYCARALEGAASLCQARAHAEILPEHWVLKLFEQGEGDLTVLARRYEWDMDAIWQ
DLLAYLDRLPRSVKGRPQLSDNLESLLKQSWLIASLENGEEIRSVHLLAAMIEMPALLSCDGLWPLLTVG
RSQLERLRGLLDAQSDERPEAQQEALLSRAPAGETTTSPVTLPSDPTEDPLSARPGLNKALQAVLDKFTQ
DITAKAKADGIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLKCVT
LRTLDLGLLQAGAGVKGEFEQRLKNIIEAVRQSPTPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARG
ELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAQHHGVHITDDAVKAAVTL
SRRYLTGRQLPDKAVDLLDTASARVRMSLDTVPEPLTQRRARISALAMEKQALLEDIAMGSHAHSERLAE
IEEEEVNILTELDVLETQYGQEITLTEQLLACRRDLSRQAESASLQSELAIVQQGTPLLGLDVDARTVAT
VIADWTGVPLSSLMKDEQTELLSLEQRLAARVVGQDVALEAIAQRLRASKTGLASENGPQGVFLLTGPSG
TGKTETALALADTLYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDE
VEKAHRDVMNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHIMQLLDEKPDASETDLHELLRPIL
RDHFQPALLARFQTVIYRPLNSQAMRTIVEMKLSQVSQRLSRHYGLTTHIDESLYDALTDACLLPDTGAR
NIDSLLAQQILPVLSQQLLCYRAAGQKPQHLTLGWSEEEGILLEFKHD
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|156936546|ref|NC_009780.1|:59747-62413 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGAGCATGGAACACCAGTCAGCCGTATTACTGCGCCGTTTAAATCCATACTGCGCCCGCGCGCTGGAAG
GCGCTGCGAGCCTGTGCCAGGCCCGCGCCCACGCGGAAATTTTGCCCGAACACTGGGTACTGAAACTGTT
TGAGCAGGGCGAGGGCGATCTCACCGTGCTGGCCCGCCGTTACGAGTGGGATATGGATGCTATCTGGCAG
GATCTGCTGGCTTACCTTGACCGCCTGCCACGCTCGGTCAAAGGTCGACCGCAGTTGTCTGACAATCTGG
AATCGCTGCTGAAGCAGAGCTGGCTTATCGCTTCACTTGAAAACGGCGAGGAGATCCGCAGTGTGCATCT
GCTGGCCGCGATGATTGAGATGCCAGCACTGCTTTCCTGCGATGGCCTCTGGCCGCTACTGACAGTGGGT
CGTAGTCAGCTTGAGCGGCTGCGCGGACTGCTTGATGCGCAGTCAGACGAACGCCCGGAGGCGCAGCAGG
AAGCGCTGTTATCCCGTGCGCCTGCCGGTGAAACAACAACGTCACCTGTAACGCTCCCCAGCGACCCGAC
AGAGGATCCGCTTTCCGCAAGGCCAGGACTGAACAAAGCGCTCCAGGCGGTGCTGGATAAATTCACCCAG
GACATTACAGCGAAGGCGAAAGCCGACGGTATTGATCCGGTTTTTGGTCGCGATAACGAAATCCGCCAGA
TGGTGGATATTCTTTCGCGTCGGCGTAAAAACAACCCGATTCTGGTGGGCGAGCCAGGCGTCGGGAAAAC
CGCGCTGGTGGAAGGACTGGCGCTGCGCATTGCTGAGGGCAATGTGCCGGAGAGCCTGAAGTGTGTCACC
TTGCGTACCCTTGATCTTGGGCTTTTACAGGCAGGCGCAGGCGTGAAAGGCGAGTTTGAGCAGCGACTGA
AAAATATCATAGAGGCTGTACGTCAGTCGCCGACGCCGGTCCTGCTGTTTATCGACGAGGCGCATACCAT
TATCGGTGCGGGCAACCAGGCGGGCGGCGCAGATGCGGCTAACCTGCTGAAACCGGCGCTGGCACGCGGT
GAACTCAGGACCATTGCAGCCACCACCTGGAGCGAGTACAAGCAATACTTTGAGCGTGACGCTGCGCTGG
AGCGTCGCTTCCAGATGGTGAAAGTCGACGAGCCGGATGACGACACCGCCTGCCTGATGCTCAGGGGGCT
CAAGTCCCGCTACGCGCAGCATCACGGTGTGCATATCACTGATGATGCGGTCAAAGCCGCCGTCACGCTC
TCACGCCGCTACCTCACTGGTCGTCAGCTTCCTGATAAAGCGGTGGATCTGCTGGATACCGCTTCGGCGC
GCGTGAGAATGAGTCTCGACACCGTACCGGAGCCACTGACGCAGCGGCGTGCCCGTATCAGCGCACTGGC
GATGGAAAAACAGGCGCTGCTGGAAGATATCGCAATGGGTAGCCACGCCCACAGCGAGCGGCTGGCAGAG
ATTGAAGAGGAAGAGGTCAATATCCTCACGGAACTGGACGTACTGGAAACGCAGTACGGTCAGGAAATTA
CCTTAACAGAACAGTTGCTGGCCTGTCGCCGTGATCTTTCCCGGCAGGCGGAGAGCGCGTCGCTGCAAAG
CGAACTGGCGATTGTGCAGCAGGGCACTCCGCTACTGGGGCTGGACGTGGACGCGCGTACCGTGGCGACA
GTGATTGCCGACTGGACCGGCGTACCGCTTTCATCCCTGATGAAGGATGAACAGACGGAGTTGCTGAGCC
TGGAGCAGCGGCTGGCCGCCCGGGTGGTTGGTCAGGACGTGGCGCTGGAGGCCATTGCACAGCGCTTACG
CGCATCGAAAACCGGGCTGGCATCAGAAAACGGCCCGCAGGGTGTGTTCCTGCTGACCGGGCCGAGCGGT
ACAGGTAAAACCGAAACCGCGCTCGCGCTGGCGGACACGCTCTATGGCGGCGAGAAATCGCTGATTACCA
TTAACCTCTCGGAATACCAGGAACCGCACACCGTTTCGCAACTCAAGGGCTCTCCTCCGGGTTACGTGGG
TTACGGCCAGGGCGGCATCCTCACGGAAGCGGTGCGCAAGCGCCCCTACAGCGTGGTGCTGCTGGATGAG
GTGGAAAAGGCGCACCGCGATGTGATGAACCTCTTTTATCAGGTGTTTGACCGCGGTTTCATGCGCGATG
GCGAAGGACGGGAAATCGACTTTCGCAACACGGTCATTCTGATGACCTCCAATCTCGGCAGTGATCACAT
CATGCAATTGCTGGACGAAAAACCGGACGCCAGCGAGACCGATCTGCATGAACTGCTGCGTCCGATATTG
CGCGATCACTTCCAGCCAGCGCTGCTGGCGCGATTCCAGACGGTGATTTATCGCCCGCTAAATTCGCAGG
CGATGCGCACCATCGTGGAAATGAAACTGTCGCAGGTCAGCCAGCGCCTGAGCCGCCACTACGGGCTGAC
GACGCATATTGATGAGAGCCTTTACGACGCTCTGACCGACGCCTGCCTGCTGCCGGACACCGGGGCACGC
AACATCGACAGCCTACTGGCGCAGCAAATTCTGCCAGTATTGAGCCAGCAATTGTTATGCTACAGGGCGG
CAGGACAGAAACCCCAGCACCTGACGCTTGGCTGGAGTGAGGAAGAGGGGATTTTGCTGGAGTTTAAACA
TGACTGA