SecReT6
Protein ID: 156936619
SecReT6 ID228
T6SS typei2
Gene symbol-
Locus tagESA_pESA3p05500
StrainCronobacter sakazakii ATCC BAA-894
Repliconplasmid pESA3 [GenBank: NC_009780] [Browse all T6SS(s) in this replicon]
Location [Strand]63673..66615 [+]
Producthypothetical protein
NoteTssI
UniProt IDA7MRE3
KEGG IDesa:ESA_pESA3p05500
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.80E-65, Aligned region: 53..374
DUF2345 [PF10106], Evalue: 2.30E-51, Aligned region: 626..776
Aspzincin_M35 [PF14521], Evalue: 1.60E-38, Aligned region: 104..121
Aspzincin_M35 [PF14521], Evalue: 1.60E-38, Aligned region: 842..980
T6SS_Vgr [PF13296], Evalue: 1.80E-32, Aligned region: 506..611
Phage_base_V [PF04717], Evalue: 2.00E-15, Aligned region: 406..501
Protein Sequence: 980 a.a.     [Download]
>gi|156936619|ref|YP_001440533.1| hypothetical protein ESA_pESA3p05500 [Cronobacter sakazakii ATCC BAA-894]
MDSRLPQGANIMSRTDTLKNTLAALTGSRLNRYRLDIPSCPSLLDVEDFSGVEAMSQLYHYDIRFTSSDL
NIDATQLLSKPATLTMGAGPLTGLVEQNVVHGVVTHFKRISGSRDQATYQISIEPFLALLGNQFRTHRFF
VNKSVPEVVEQILREHGLHEWEYEFRLKQVYPPREQINQYQENDLAFIERLLSELGIFYFFTLQPDARTE
VVHFADRQSAWQFGKTLPLNSPSGAHDNGVDSVWGVSVRHNVVERSVTANDYNHRQAQKILMSAPADMTR
GDGEGVTYGDVYHYRPRHLERGDKLDPAAETGNFWARLEHERFLSEQTRVTGSSTDHTLSPAQVLTITET
AIPPTLPDEIDNGVVIISAGYSASRKNALHVAWVGMPYSETVCWRPPLLPRPKVSGTMTARVTSARAGDI
YAWQDAAGLYRVKFDADRDDKSPGQESMPVRLAKPYGGDVYGFHFPLIQGTEVAIAFHEGDPDRPYIAHA
LHDSRHPDHVTEANNTRNVIRTPANNKLRMEDRRGEEHIKLSTEYGGKSQLNLGHNVDAGRSLRGEGAEL
RTDRWVSIRGGAGVFITADKQSAGDKMLSMKEAIAQLENALSIARSLSDAAESADALPSDIRSQVTLTNA
LKDLVKPGMVLNAPEGVSITSPQAVRVASGSASVGIMSQQNTDISALSRVTVAAGEAVSVLAKQAGMKLF
AAKGKVEIQAQDDALEALAKKEVTVTSTEGRVDITAATELVINCGGAYIRLSDGNIELGCPGNILLRSTN
AQKMSPYEYKGNSWSKSGKGNGVILRNQYGDPVRDANGNIVYEMEESKRPSPEVMKKALQAQKEMLLKRK
AELERWSEEDQKAFKKAFGRTDDASRKKIAAAVDKEIELNDSMSYDNFKFADQNVHAYVFQGDTEDHFIY
IGNKFSGDPLTGPDSQVVTLSHEMSHYNDVLGTDDITIGNMDFEKAAINFAQDCSDNALDNAYNFERYFQ
 
Nucleotide Sequence: 2943 bp     [Download]
>gi|156936546|ref|NC_009780.1|:63673-66615 Cronobacter sakazakii ATCC BAA-894 plasmid pESA3, complete sequence
ATGGACAGCAGATTACCCCAAGGAGCCAATATCATGAGTCGGACCGATACGCTTAAAAATACCCTGGCTG
CGCTAACGGGAAGCAGGTTGAACCGCTACCGTCTGGATATTCCGTCATGCCCTTCATTACTGGATGTCGA
AGATTTTAGCGGCGTCGAGGCAATGAGCCAGCTCTACCACTATGACATCCGGTTCACCAGCAGCGACCTT
AACATTGATGCCACGCAGCTGCTGAGCAAACCGGCCACGCTGACCATGGGTGCCGGCCCACTGACGGGGC
TGGTTGAGCAGAATGTGGTGCACGGCGTGGTGACGCACTTTAAGCGTATCAGCGGCTCACGCGACCAGGC
GACATACCAGATTAGTATTGAGCCGTTTCTGGCGCTGCTCGGTAATCAGTTCCGCACCCACCGCTTTTTC
GTCAATAAATCAGTACCGGAAGTGGTGGAGCAGATCCTCCGGGAACACGGCCTGCACGAGTGGGAATATG
AGTTCCGCCTTAAACAGGTTTATCCGCCGCGTGAGCAAATTAATCAGTACCAGGAAAATGACCTGGCGTT
TATCGAACGTCTGCTGTCTGAGCTGGGAATATTTTATTTCTTTACCCTGCAACCAGACGCCAGGACGGAG
GTGGTGCATTTTGCCGACAGGCAGAGCGCCTGGCAGTTTGGTAAAACACTGCCGCTGAACAGCCCGTCAG
GCGCGCATGACAACGGTGTGGATTCGGTGTGGGGCGTGAGTGTACGGCACAACGTAGTCGAACGCAGCGT
GACGGCCAATGATTACAACCACCGACAGGCGCAGAAAATACTGATGTCCGCCCCGGCGGATATGACCCGG
GGCGACGGAGAGGGCGTCACTTACGGCGATGTATATCACTATCGTCCGCGCCATCTTGAGCGAGGCGACA
AACTCGATCCAGCAGCGGAAACCGGAAATTTCTGGGCGCGGCTGGAGCATGAGCGTTTTCTGTCTGAGCA
GACCCGCGTAACTGGCAGCAGTACCGACCATACGCTGAGCCCGGCACAGGTGCTCACCATTACTGAGACC
GCCATTCCGCCGACGCTGCCGGATGAGATCGACAATGGCGTCGTCATTATCAGTGCCGGTTACTCTGCCA
GCCGTAAAAATGCACTGCACGTGGCGTGGGTGGGAATGCCCTACAGCGAAACAGTGTGCTGGCGTCCGCC
GTTGCTGCCGCGCCCGAAGGTCAGCGGCACCATGACGGCCCGGGTGACCAGCGCCCGGGCGGGGGATATC
TACGCCTGGCAGGACGCGGCCGGTCTGTACCGGGTGAAGTTTGACGCAGACCGTGACGACAAATCGCCCG
GCCAGGAGAGCATGCCGGTACGCCTGGCGAAACCCTACGGCGGGGACGTGTACGGGTTTCACTTCCCGCT
GATACAGGGCACGGAGGTGGCGATAGCCTTTCACGAAGGCGACCCGGACCGGCCATATATCGCCCATGCG
CTGCACGATTCGCGCCATCCGGACCACGTGACGGAGGCGAACAACACCCGCAATGTGATACGCACGCCGG
CCAACAACAAGCTGCGGATGGAGGACAGACGCGGCGAGGAACATATCAAACTCAGTACGGAGTACGGCGG
CAAGTCGCAGCTTAATCTGGGACATAACGTGGATGCGGGGCGGTCACTGCGTGGCGAAGGCGCAGAGCTG
CGCACCGACAGATGGGTGAGTATCCGCGGCGGCGCCGGGGTGTTTATTACGGCGGACAAGCAGTCAGCGG
GCGATAAAATGCTTTCCATGAAAGAGGCGATTGCGCAGCTGGAGAACGCGCTGAGCATCGCGCGGAGCCT
GTCGGATGCGGCAGAAAGTGCAGACGCGCTGCCGTCGGATATCCGGAGCCAGGTGACGCTGACGAACGCC
CTTAAAGACCTGGTGAAACCGGGGATGGTGCTGAATGCGCCGGAAGGGGTGAGCATCACCAGCCCGCAGG
CGGTGCGCGTGGCGTCCGGCAGCGCGAGCGTGGGGATAATGTCTCAGCAGAACACGGACATCAGCGCCCT
GAGTCGCGTTACGGTGGCGGCGGGTGAGGCGGTGAGCGTGCTGGCGAAACAGGCTGGTATGAAGCTGTTT
GCGGCGAAAGGGAAAGTGGAAATCCAGGCGCAGGATGATGCGCTGGAGGCGCTGGCCAAAAAGGAAGTCA
CCGTCACCAGTACGGAAGGTCGGGTGGACATCACGGCGGCAACAGAACTGGTGATTAACTGCGGGGGCGC
CTATATCCGGCTCAGCGACGGAAATATCGAACTGGGATGCCCCGGAAATATTTTACTCAGATCAACGAAT
GCGCAAAAAATGTCTCCTTATGAATACAAGGGAAACAGCTGGTCAAAATCGGGCAAGGGAAACGGAGTTA
TTTTAAGAAATCAGTATGGCGATCCGGTAAGAGATGCGAATGGTAATATCGTCTATGAGATGGAGGAAAG
TAAGCGGCCTTCTCCGGAGGTTATGAAAAAGGCATTGCAGGCTCAGAAAGAGATGCTGCTTAAGAGGAAA
GCCGAACTGGAACGCTGGAGCGAAGAGGATCAGAAAGCCTTTAAAAAAGCGTTTGGACGTACAGATGATG
CTTCCAGAAAAAAGATCGCTGCTGCGGTTGACAAAGAAATCGAACTCAACGACTCAATGTCCTACGATAA
CTTCAAGTTTGCCGATCAGAATGTACATGCATATGTTTTTCAAGGAGACACAGAGGACCATTTTATCTAT
ATAGGTAATAAATTTTCTGGAGATCCTTTAACTGGCCCGGATTCTCAGGTAGTGACTCTCAGCCATGAAA
TGTCACATTATAATGATGTTTTGGGAACTGATGATATAACTATCGGAAATATGGATTTTGAGAAAGCTGC
GATTAATTTTGCGCAAGACTGTTCAGATAATGCGCTTGATAATGCTTATAACTTTGAAAGGTATTTTCAA
TGA