SecReT6
Protein ID: 156977066
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05851
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1035676..1036467 [-]
Producthypothetical protein
NoteTssL
UniProt IDA7N4Q7
KEGG IDvha:VIBHAR_05851
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.00E-55, Aligned region: 46..248
Protein Sequence: 263 a.a.     [Download]
>gi|156977066|ref|YP_001447972.1| hypothetical protein VIBHAR_05851 [Vibrio harveyi ATCC BAA-1116]
MSYAETDVTVVLFQPEPGKPMEVMPAPDLSRNIAVQDLNIENMGINPLVDQFSWLIASLSCMSSIPWLDD
PMPFREQVAREIRKGERKLNEMELDRASILVIRYCLCAAIDESVCRQEWGANSHWSQNSLLSEFHNETSG
GDKFFVILERLKADPRKYRHVIEFLYLLLQLGFQGKYGREERGNEKLAEIGNTIYRLVRDERLAEQEKVS
LVNLKAKYLKKPLKRVISPKLILGVSAITFAIMYAATYIVIDLKFQQLLEVYR
 
Nucleotide Sequence: 792 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1036467-1035676 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGAGTTATGCAGAAACCGACGTCACCGTAGTCTTATTCCAACCAGAGCCTGGCAAACCGATGGAGGTGA
TGCCAGCGCCTGACTTATCTCGTAACATCGCGGTACAAGACTTAAACATTGAAAACATGGGCATCAACCC
TTTGGTCGATCAGTTCTCTTGGTTGATCGCCAGTTTGTCTTGTATGTCCTCAATTCCTTGGCTTGATGAC
CCAATGCCGTTTCGTGAACAAGTGGCTCGCGAGATAAGAAAAGGCGAACGTAAGCTCAATGAAATGGAAT
TGGATCGCGCATCCATTTTGGTCATCCGATACTGTTTGTGTGCTGCGATTGATGAATCGGTTTGCCGACA
AGAGTGGGGCGCTAACAGCCATTGGAGCCAGAACAGTTTGTTGTCCGAGTTCCACAATGAAACATCTGGC
GGCGATAAGTTTTTCGTTATTCTCGAGCGTTTAAAAGCAGACCCGCGCAAATACCGTCACGTCATCGAGT
TTCTCTATTTGCTGCTTCAACTTGGCTTTCAAGGCAAATACGGCCGTGAAGAGCGTGGTAACGAAAAGCT
CGCAGAAATCGGCAATACCATTTATCGCCTAGTGCGTGACGAACGTTTGGCGGAGCAAGAGAAAGTCTCT
CTGGTTAACCTTAAGGCCAAATACCTCAAGAAACCGTTAAAAAGGGTGATTTCACCCAAACTGATTTTAG
GCGTCAGTGCGATCACCTTCGCAATCATGTATGCCGCGACTTACATCGTTATAGATTTAAAGTTTCAGCA
ATTGCTTGAAGTGTATCGATAA