SecReT6
Protein ID: 156977067
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05852
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1036464..1037789 [-]
Producthypothetical protein
NoteTssK
UniProt IDA7N4Q8
KEGG IDvha:VIBHAR_05852
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-140, Aligned region: 19..440
Protein Sequence: 441 a.a.     [Download]
>gi|156977067|ref|YP_001447973.1| hypothetical protein VIBHAR_05852 [Vibrio harveyi ATCC BAA-1116]
MSLYNPVVWQDGMFMKPQHFQQLDRSQSKLSSMLSANASPLHWGIKRLEINSQLLALGKIGITRAEGILQ
DRTPFELPLLAELPEVKDVDPSIADKVVYLCCPLPSERSELFGTKKDGARYTMESQEAVDACYDSEDMAN
IVVGKLNFCLMYDHEDKSAYTSIPILKISEVKPDGSVILDESFIPTCIDIHASTVLNKFATEFASMLKHR
AESIVQRLGVVDQQGVSSVSDFMLLQALNRYEPLFWHFASAEGVHPESFYRILLQAEGELSTLCSASRRP
VEFTKYNHGDLTSCLSRTLDSAKMTLSVMSEQRAIPLTLRDQNYGIRTAAIPDSKIIDTTTFILAVKADV
TLDVLHTQFVSQTKIGSIDNIRDLINLQLPGIEIKPMPVVPRALPYHAGYTYFELDKTGEEWAALKNTAA
IAVHVAGDFANLSLQLWAVRL
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1037789-1036464 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTCTTTATACAATCCAGTTGTTTGGCAAGATGGAATGTTCATGAAGCCGCAGCACTTTCAGCAACTCG
ATCGTTCGCAAAGTAAACTGTCGAGCATGCTGAGCGCCAATGCGTCGCCTCTACATTGGGGAATTAAGCG
TTTAGAGATCAACTCGCAACTGCTGGCGTTGGGCAAAATTGGTATTACTCGTGCTGAAGGTATTCTTCAA
GACAGAACGCCATTCGAGTTGCCGCTGCTAGCTGAACTTCCAGAAGTGAAAGACGTTGATCCTTCGATTG
CTGACAAGGTGGTTTACCTTTGTTGTCCGCTACCTTCTGAGCGCTCTGAGCTATTCGGCACTAAGAAAGA
CGGCGCACGTTACACGATGGAATCTCAAGAGGCGGTTGACGCTTGTTATGATTCGGAAGATATGGCAAAC
ATCGTAGTCGGTAAGCTTAACTTCTGTTTGATGTATGACCATGAAGATAAGAGTGCTTACACATCGATTC
CAATTCTAAAGATCTCAGAAGTAAAGCCAGACGGCAGTGTCATCTTAGATGAGAGCTTTATCCCGACTTG
TATTGATATCCACGCTTCGACCGTACTGAACAAGTTCGCCACCGAATTCGCATCTATGCTGAAACACCGT
GCAGAATCTATCGTTCAGCGCTTAGGCGTGGTTGACCAGCAAGGCGTATCTTCGGTTTCTGATTTCATGC
TGCTACAAGCCCTAAACCGATACGAGCCGCTATTCTGGCACTTTGCAAGCGCTGAAGGGGTTCATCCTGA
GTCGTTTTATCGCATTCTTCTTCAGGCGGAAGGTGAGCTTTCGACTTTGTGTTCAGCGTCTCGTCGTCCA
GTCGAGTTCACCAAATACAACCATGGCGACCTAACCAGCTGTCTATCGCGTACATTGGATAGTGCGAAGA
TGACACTAAGTGTGATGTCTGAGCAACGTGCAATCCCTCTGACGTTGAGAGACCAAAACTACGGCATTAG
AACGGCAGCGATTCCAGACAGCAAGATCATCGATACCACAACCTTTATTCTTGCGGTTAAAGCTGATGTT
ACTTTGGATGTTCTACATACTCAGTTTGTTAGCCAAACGAAGATCGGTTCTATCGATAACATTCGTGACT
TGATTAACCTTCAACTGCCGGGCATCGAGATCAAACCAATGCCAGTTGTACCTCGAGCATTGCCTTACCA
CGCAGGTTACACCTACTTCGAACTGGATAAGACAGGCGAAGAGTGGGCGGCACTGAAAAACACGGCTGCG
ATAGCGGTTCACGTAGCCGGCGACTTTGCTAACTTGTCATTGCAACTATGGGCTGTTCGTCTATGA