SecReT6
Protein ID: 156977068
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05853
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1037801..1038250 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA7N2A4
KEGG IDvha:VIBHAR_05853
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-31, Aligned region: 12..135
Protein Sequence: 149 a.a.     [Download]
>gi|156977068|ref|YP_001447974.1| hypothetical protein VIBHAR_05853 [Vibrio harveyi ATCC BAA-1116]
MWGQFKESTGITPETSSIELVIEASSVLNVREGGQSSPVILRVHELTSPVLFRSLDFFALFENDKASLGD
EYIKRYEYQMQPGEKIHEFLELDPATRAVGFSVAFRDIDGSSWRKVEVIEEKSEYYIKLKLEGSELISDN
TRGIEQVYF
 
Nucleotide Sequence: 450 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1038250-1037801 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTGGGGGCAATTTAAAGAATCAACAGGCATTACGCCAGAAACGTCCTCAATCGAATTAGTGATTGAGG
CGTCTTCGGTTCTGAATGTTCGTGAAGGTGGGCAATCCTCTCCAGTTATTTTGCGAGTTCATGAGCTGAC
ATCACCCGTGTTGTTTCGCAGCTTAGACTTCTTCGCTTTGTTTGAGAACGATAAAGCATCACTGGGTGAT
GAATACATCAAACGTTATGAATACCAAATGCAGCCTGGTGAAAAGATCCACGAATTCTTGGAGCTTGACC
CAGCAACCCGTGCGGTTGGATTCTCAGTCGCGTTTCGCGATATCGACGGCTCTTCTTGGCGTAAAGTCGA
AGTGATTGAAGAGAAGAGCGAGTACTACATCAAACTCAAGTTAGAAGGCAGTGAGTTAATTTCTGACAAC
ACTCGCGGCATTGAACAAGTTTACTTTTAA