SecReT6
Protein ID: 156977069
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05854
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1038294..1039808 [-]
Producthypothetical protein
NoteFha
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.10E-17, Aligned region: 31..97
Protein Sequence: 504 a.a.     [Download]
>gi|156977069|ref|YP_001447975.1| hypothetical protein VIBHAR_05854 [Vibrio harveyi ATCC BAA-1116]
MQTHQLVLFISKCPEEYTGAKHVEMPEGGGSVGRAPSCTLPLTDHNRFISGTHCLISVYGDTYYISDVST
NGTMVNGNKILKNQPVSIVDGDVISLGQYEIGVSLEHVTAAQDIASDIAPERVSNDPLVNLGEAVVEEEE
KVGALEDLFTETKQDDVNTDDPIAHLKFSMQREDDHLIRDVEKPEPAKAKPVENTRQVVDDSFSIHSEFD
IPNLIPEDWLGGTATNKASVEPAAEQTKQAAFIPEDFAQTEAVPLQARRVEPEVTQPQMPQYQAPHNHAA
SNVTQRAEPVGQKWEEVTQAFIPSAQPTQPETKATENQVGFVSNDPLGAESATHSSDIGKAFYEGLGISN
PDLISNEALLFKQMGTCLRLCIDNLQKDLHEVESLKGEQGLSEADSNLAELMLTLNSQNLLSPNELVEQM
LDELNDHQIIFNKALNELLIEQSETNDPVTFANDVASKSMFTTKSKLWGEYLEFYANNRRQMNETSLKGL
IKKNYTKAIKGSHA
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1039808-1038294 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGCAAACACATCAGCTAGTCCTATTCATTTCAAAGTGCCCGGAGGAATATACGGGCGCGAAGCATGTTG
AAATGCCAGAAGGTGGTGGTTCAGTCGGCCGAGCACCGAGCTGTACACTGCCTTTGACTGATCATAACCG
TTTCATCTCTGGCACACATTGTCTGATCAGCGTATACGGAGACACGTACTACATCAGCGATGTGTCGACC
AACGGCACAATGGTGAATGGCAACAAAATACTTAAGAACCAACCTGTGTCCATTGTTGATGGCGATGTGA
TTTCTCTGGGTCAATACGAAATTGGTGTTTCGCTAGAGCATGTCACAGCAGCGCAAGATATTGCTTCTGA
CATTGCGCCAGAACGTGTATCGAATGATCCACTCGTCAATCTCGGTGAGGCGGTTGTAGAAGAGGAAGAA
AAAGTCGGTGCATTAGAAGACTTGTTCACGGAGACCAAGCAAGATGATGTCAATACTGACGATCCTATTG
CTCATCTAAAGTTTTCGATGCAGCGTGAAGACGACCATCTTATCCGCGATGTCGAAAAGCCAGAACCTGC
AAAGGCTAAGCCAGTCGAAAACACGCGACAAGTCGTTGATGACAGCTTCAGCATCCATTCTGAATTCGAT
ATTCCAAACTTAATCCCGGAAGATTGGTTGGGAGGCACTGCCACGAATAAAGCATCTGTCGAACCCGCGG
CAGAACAAACTAAACAAGCGGCGTTCATTCCAGAAGATTTTGCGCAAACGGAAGCCGTTCCACTTCAAGC
TCGTAGGGTGGAACCAGAGGTTACCCAGCCTCAAATGCCTCAATATCAAGCGCCACATAATCACGCAGCA
TCAAACGTTACTCAAAGAGCAGAGCCTGTTGGGCAGAAATGGGAAGAGGTAACGCAAGCTTTTATTCCAT
CAGCACAACCTACTCAGCCAGAAACGAAAGCGACAGAGAACCAAGTCGGCTTTGTAAGCAATGATCCACT
AGGAGCCGAGAGCGCTACGCATTCTTCCGATATCGGTAAAGCATTTTATGAAGGTTTGGGTATTAGCAAC
CCAGATCTGATCAGCAACGAAGCTCTGTTGTTTAAACAGATGGGTACATGTCTTCGTTTATGTATCGATA
ACCTGCAAAAAGACCTGCATGAAGTTGAGTCACTCAAAGGTGAACAAGGTTTAAGTGAAGCGGATTCAAA
CTTAGCGGAGCTGATGCTGACGCTAAATAGCCAGAACTTGCTGTCTCCGAATGAATTGGTGGAGCAAATG
TTGGATGAGCTCAACGATCATCAAATTATTTTTAACAAGGCTCTCAATGAGTTGCTGATTGAACAATCAG
AGACGAATGACCCTGTCACGTTTGCAAACGACGTTGCAAGTAAATCCATGTTCACCACCAAATCAAAGCT
ATGGGGTGAGTATCTTGAGTTTTACGCCAATAACCGTCGCCAAATGAATGAGACATCATTGAAAGGCTTG
ATCAAGAAAAACTACACCAAAGCGATTAAGGGAAGCCATGCGTAG