SecReT6
Protein ID: 156977071
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05856
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1041040..1042344 [+]
Producthypothetical protein
NoteTssA
UniProt IDA7N2A7
KEGG IDvha:VIBHAR_05856
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.00E-18, Aligned region: 46..104
Protein Sequence: 434 a.a.     [Download]
>gi|156977071|ref|YP_001447977.1| hypothetical protein VIBHAR_05856 [Vibrio harveyi ATCC BAA-1116]
MFFSDFARRPIDESNPSGSNPNGLDDFDEIKRQINNLNKVTGRVSWKTIQTLSKKILSTQGKDFRCSCYF
TVAATHNDGLKGLVEGLNSLLDLCVVYWYTAYPEHAKANARISAIEWMVEYTEKRIKKHRALPEELPLIE
AAHQLCLRIEEELRLHYGIKAPSFGRIRRILNQWIEEIKETKAKEAKALEVKQEKPETPSNPGGIQVNIA
PPPKTETKPTPQPQVKEAPKSSRAVVFSVIGLLVVAFASHFVYKQHKYQTLKDDIEHSSLKQLAAIVDSL
SVENKEHRIALRSATVERLDALMTDWAIDPVKVSEVNTIDELTSELTEIYPDSSSAQQLRENFLDQRSRF
ENEFDVIYKRFAYARTVFANVAKQNTDRDSKKAYEYSNSLFPLLGRIEYAEKNAQQKEIERSLLLLNAYL
YKINQLQTATNDNK
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|156975952|ref|NC_009784.1|:1041040-1042344 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTTTTTCAGCGACTTCGCTAGAAGGCCGATCGATGAAAGTAATCCAAGCGGCTCAAACCCTAATGGCT
TAGATGATTTTGACGAAATTAAGCGCCAGATAAATAACCTGAATAAAGTGACTGGTCGAGTATCATGGAA
AACGATTCAAACACTTTCTAAGAAAATTCTTAGTACTCAGGGGAAAGATTTTCGTTGTAGTTGCTACTTT
ACCGTGGCGGCTACGCACAACGATGGCTTGAAAGGCTTGGTTGAAGGCTTGAACTCACTGCTCGACTTAT
GTGTTGTGTATTGGTACACCGCCTACCCAGAGCACGCGAAGGCCAATGCACGTATCAGTGCCATCGAGTG
GATGGTCGAATACACTGAGAAGCGAATTAAAAAGCATCGAGCCTTACCAGAAGAGCTCCCGCTTATTGAA
GCGGCGCATCAACTGTGTTTACGCATCGAAGAAGAACTGCGCCTACATTATGGGATTAAAGCGCCATCAT
TCGGTCGCATTCGTCGTATATTGAACCAATGGATTGAAGAGATTAAAGAAACAAAAGCAAAGGAAGCTAA
AGCATTAGAAGTCAAACAAGAGAAGCCAGAAACACCATCGAATCCAGGTGGCATCCAAGTCAATATTGCG
CCGCCACCAAAAACGGAAACCAAGCCGACGCCTCAGCCGCAAGTAAAAGAAGCGCCTAAGTCCAGCCGCG
CGGTTGTATTTTCTGTTATTGGATTGCTTGTCGTTGCATTTGCTTCCCACTTTGTTTACAAGCAGCACAA
ATACCAGACTCTGAAAGATGACATTGAACACTCGTCACTAAAACAGCTAGCAGCAATCGTCGATTCATTG
AGCGTTGAGAACAAAGAACACCGCATCGCTTTACGTTCTGCGACGGTCGAACGCCTTGATGCATTAATGA
CCGATTGGGCAATCGATCCTGTAAAAGTCAGCGAAGTGAATACCATTGATGAGCTTACTAGTGAATTGAC
GGAGATCTACCCAGATTCATCATCTGCTCAGCAACTTCGAGAGAATTTTTTAGACCAACGTTCTCGTTTC
GAAAATGAATTCGATGTCATATACAAACGCTTTGCTTATGCTAGGACGGTATTTGCCAACGTAGCGAAAC
AGAACACCGACAGGGACTCGAAGAAAGCGTATGAATACAGCAATTCGCTGTTCCCGCTTCTTGGGCGGAT
TGAGTACGCAGAAAAGAATGCGCAGCAAAAGGAAATTGAACGCTCCCTCCTTTTACTGAACGCCTACCTA
TATAAGATTAATCAGTTGCAAACTGCAACAAACGACAATAAATAA

Protein ID: 156977079
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05864
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1051589..1053190 [-]
Producthypothetical protein
NoteTssA
UniProt IDA7N4P5
KEGG IDvha:VIBHAR_05864
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-18, Aligned region: 48..108
ImpA-rel_N [PF06812], Evalue: 2.20E-18, Aligned region: 507..520
Protein Sequence: 533 a.a.     [Download]
>gi|156977079|ref|YP_001447985.1| hypothetical protein VIBHAR_05864 [Vibrio harveyi ATCC BAA-1116]
MSVIDIERLLTPISDAAPVGEDARYEFCYEMMESEVKKFGSLFGETVDWTVVKTHATEVLEQHSKDLKAI
CYLIRALTEEFGLQGFEQGLKLLSHALSQFGGELYPSRKRGRDGAVEWLNHQFKLVSSKLVESPQSWALV
SSCISTIEEVQRQYDDVYQDSEADFFEIRTQLNMLSQQAAVDGQSDDGSASEVQPEQAPSVPVSITQPEQ
TNTAVYSPKPEEAQSAPVKPLSPAPKPAPVKKAVTQEVYVDTDFSSPTASKRTLKKVAEVMIHANPSDPL
AYRIYRHLTWDDIDGLPDHQNNETPLSLAVSSDQQADYRDKANQESDIDTIKRLERTLTDAPFWLTGHHF
VYSMLNNLGFDDAAIAVKQEVKRFVDSLEGIEHLSFKNSIPFADEATLSWLSTQDAASSTSQPVVQTVVI
SEEDSLPMEDITLENLGEYAAELARKLELDSSGRGQFMLYLQLIAAYQSVGLYPLCLPYLEKGWEVQKAF
NLASWEPHLSSQLEDLIRKTLHQLFRSKDLLPEKYEEWQAIYD
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1053190-1051589 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTCAGTGATTGATATCGAACGTTTGCTTACGCCAATTTCTGATGCTGCTCCGGTAGGTGAAGACGCGC
GCTACGAGTTTTGCTATGAAATGATGGAATCCGAAGTGAAGAAGTTCGGCTCATTATTTGGTGAAACGGT
AGATTGGACGGTCGTTAAAACGCACGCAACAGAAGTCTTAGAACAGCACAGCAAAGATTTAAAAGCGATC
TGTTACTTGATTCGGGCACTAACGGAAGAGTTTGGCTTACAAGGTTTCGAACAAGGCTTAAAGCTGCTTA
GTCATGCGTTAAGTCAGTTTGGTGGTGAGCTTTACCCTTCGCGTAAGCGTGGTAGAGATGGCGCGGTAGA
ATGGCTTAACCATCAGTTTAAACTGGTAAGCAGTAAGTTAGTGGAAAGCCCGCAGTCTTGGGCGTTGGTT
TCAAGTTGTATTTCTACTATCGAAGAAGTGCAGCGTCAGTACGACGACGTTTATCAAGATTCAGAAGCAG
ATTTTTTTGAGATCCGTACTCAGCTCAATATGTTATCTCAGCAAGCTGCTGTCGATGGCCAGAGCGATGA
CGGCTCTGCAAGTGAAGTTCAACCTGAACAAGCGCCTTCTGTGCCGGTAAGCATTACTCAACCTGAGCAA
ACGAATACTGCTGTTTATTCGCCAAAGCCAGAAGAGGCTCAAAGCGCACCAGTTAAGCCGCTGTCGCCAG
CTCCGAAGCCAGCGCCAGTCAAGAAGGCCGTCACACAAGAAGTCTATGTTGATACGGACTTCTCATCACC
GACGGCATCGAAACGTACGCTTAAGAAAGTCGCGGAAGTGATGATTCACGCTAACCCAAGTGACCCTTTG
GCATACCGAATTTATCGTCATCTGACTTGGGATGACATTGATGGTCTTCCTGATCATCAAAACAACGAAA
CGCCATTGAGCTTGGCGGTGTCTTCGGATCAACAGGCGGACTATCGTGACAAAGCTAATCAAGAAAGCGA
CATCGACACGATTAAACGGTTGGAGCGTACATTAACTGATGCACCATTCTGGCTGACGGGGCATCACTTC
GTGTACTCGATGCTCAATAACTTGGGCTTTGATGATGCGGCCATCGCTGTAAAGCAAGAAGTGAAACGTT
TTGTTGATTCATTAGAGGGCATTGAGCACCTCTCATTTAAGAATTCTATACCATTTGCAGATGAAGCAAC
CTTGAGCTGGTTATCGACTCAAGATGCAGCTTCTTCAACTTCTCAACCTGTAGTGCAAACAGTTGTGATC
TCTGAAGAAGATTCGCTGCCGATGGAGGATATCACTCTAGAAAACCTAGGGGAATATGCCGCAGAACTTG
CCCGCAAACTCGAGCTGGATAGCTCGGGACGTGGACAGTTTATGCTGTATTTACAATTGATAGCAGCTTA
CCAGTCTGTTGGATTATACCCATTGTGTCTGCCTTATCTTGAGAAGGGTTGGGAAGTACAAAAAGCGTTT
AATCTCGCGAGCTGGGAACCCCACTTATCGTCACAGTTAGAAGACCTGATTCGAAAAACACTCCATCAGT
TATTCAGAAGTAAGGATCTTTTGCCTGAGAAGTATGAAGAGTGGCAAGCAATTTATGACTAA