SecReT6
Protein ID: 156977074
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05859
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1046346..1047344 [-]
Producthypothetical protein
NoteTssG
UniProt IDA7N2B0
KEGG IDvha:VIBHAR_05859
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-87, Aligned region: 8..317
Protein Sequence: 332 a.a.     [Download]
>gi|156977074|ref|YP_001447980.1| hypothetical protein VIBHAR_05859 [Vibrio harveyi ATCC BAA-1116]
MITTLTDKSYEFSFYQAVLLLEKHYQLEPNSNFVAVGENKYFHQERIEFSVSPSMAFPKSDMEFITHMER
NGQQYSRVETNFLGLHGSSSPLPASYTEKLAGRDPDDNPVKDFFDFFHNRYTSLLYRVWKKYRYHVQYQS
GASDAFSGRILHLAGLSDVMQDCDVAELDRAKILSYVNQLSTRTRSPKLISGIVSHYFSLPSVRIEEWVY
RRVDIAESQRNKLNRANCVLGQTLHLGQSIADLNGKFNLCIDNIDFETFRQFSYDGELHKTLVGLMRFIL
RDPMSWDLKLTVNLDSIPENQLGNGEGNQLGQTFWLGNPGEKDAKIRLIGSI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1047344-1046346 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGATTACAACACTTACTGATAAGTCGTATGAGTTCAGCTTCTATCAAGCGGTATTGTTGCTTGAGAAGC
ACTACCAGCTAGAGCCAAATTCTAACTTTGTCGCGGTTGGTGAGAACAAGTACTTCCACCAAGAGCGCAT
AGAGTTTAGTGTCTCGCCGAGTATGGCTTTTCCAAAGAGTGATATGGAATTTATCACTCACATGGAAAGA
AATGGGCAACAGTATTCGCGCGTCGAGACGAACTTTTTAGGTTTACATGGGTCAAGTTCGCCATTGCCAG
CGTCGTATACCGAAAAGCTTGCTGGTCGTGACCCAGATGATAACCCGGTAAAAGACTTCTTTGATTTCTT
CCACAATCGTTACACTAGCTTACTGTACCGTGTCTGGAAGAAATACCGTTATCACGTACAGTACCAAAGC
GGTGCAAGTGACGCGTTCTCAGGGCGGATCCTGCATTTGGCCGGCCTGTCTGATGTCATGCAAGATTGCG
ATGTCGCGGAGTTAGATCGAGCAAAGATCCTCTCTTATGTTAACCAGCTGTCTACCCGCACACGATCTCC
TAAGCTGATTTCCGGTATTGTTTCCCATTACTTCTCGCTACCGAGTGTACGAATCGAAGAGTGGGTGTAT
CGACGAGTAGACATTGCAGAAAGTCAACGCAACAAGCTTAACCGTGCCAACTGTGTATTAGGGCAGACCT
TACATTTGGGGCAAAGTATTGCGGATTTGAACGGCAAATTTAACTTGTGCATCGACAACATTGATTTTGA
GACGTTTAGGCAATTTTCCTACGATGGCGAGCTGCACAAGACGCTGGTGGGATTGATGCGTTTTATTCTA
CGTGACCCGATGTCTTGGGACCTTAAGCTAACTGTGAATCTCGATTCTATCCCAGAGAATCAGCTGGGTA
ATGGGGAAGGGAATCAGTTGGGTCAAACCTTTTGGCTTGGTAACCCAGGTGAGAAAGATGCCAAGATACG
TTTGATTGGTAGCATATAG