SecReT6
Protein ID: 156977075
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05860
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1047341..1049089 [-]
Producthypothetical protein
NoteTssF
UniProt IDA7N2B1
KEGG IDvha:VIBHAR_05860
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-191, Aligned region: 5..582
Protein Sequence: 582 a.a.     [Download]
>gi|156977075|ref|YP_001447981.1| hypothetical protein VIBHAR_05860 [Vibrio harveyi ATCC BAA-1116]
MSNSKYFQDELTYLRESGSEFAKYHPKLTHFLSEGTFDPDVERLLEGFAFLTGRIREKIDDELPELTQSL
MTLLWPHYMRSIPSLCISELKPHTGSVTEKTVVKRGAEMASEQVEGTQCLFRTCYDVNLYPITITNIEQT
NSRTSSAIDVTLSTEHGLELSRIGLDTLRLHLHGEIYVTRTVFLWLFRYLDYVELDVGGGYKHRLGPEYV
KPVGHEEDEALLPYSKNSFAGYRLLQEFFSLPEKFMFFDIQGLEWLKGIPQRSTVKVKFFFKRALPSEVV
LKDKHLRLHCTPAVNLFEKDGDPIRLEHRRNEYKVRPQSNTQDHYEVYGIEQVESWSKDERRRKPLIEFE
SFEHQINQRDKREFYKSKVGERVSGRGLERYISFHTHNGDIADLGTETVLMKLQCSNADLAERLSVGDIT
YATHKSPTYATFKNITKPTQSVSPQVNGELQWQLIANMSLNYLSLANIDVLKVLLSTYDFHSRVDRQAHR
ASIHRLDGIVSSEMKPIDRVFRGVSVRGNQFKLVTNSKFFVNEGDMFLMATVLNEFIRLYSSVNSFTELE
VFDEATGEVYNWASLIGQQTIL
 
Nucleotide Sequence: 1749 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1049089-1047341 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
TTGAGTAACAGTAAATACTTTCAAGATGAACTCACGTATTTGCGTGAGTCGGGTAGTGAGTTTGCCAAAT
ATCATCCGAAGTTAACTCACTTTCTCTCTGAAGGAACCTTCGACCCAGACGTCGAGCGACTGCTGGAAGG
TTTCGCTTTTCTGACTGGGCGTATTCGAGAGAAGATCGACGACGAACTGCCAGAACTCACGCAATCTCTG
ATGACTTTGCTGTGGCCGCATTACATGCGTTCAATTCCGTCTTTGTGCATCAGTGAGCTAAAACCGCATA
CCGGAAGTGTTACTGAGAAAACGGTGGTAAAACGTGGTGCAGAAATGGCCAGTGAGCAAGTCGAGGGCAC
GCAATGCCTTTTCCGCACTTGCTACGATGTGAACCTATACCCAATCACGATCACCAATATTGAACAAACC
AACAGCCGCACCAGTTCAGCGATTGATGTAACGTTGTCGACGGAGCATGGTCTAGAGCTGTCTCGAATTG
GTTTAGATACGTTGCGTTTGCACTTGCATGGTGAAATTTATGTTACTCGCACTGTGTTTCTCTGGCTGTT
CCGCTACTTGGATTACGTGGAGCTGGATGTCGGTGGCGGCTACAAACATCGCTTGGGGCCAGAATATGTC
AAGCCGGTAGGGCATGAAGAAGACGAAGCGCTGCTGCCTTATAGCAAAAACTCTTTCGCAGGATACCGCT
TGTTGCAAGAGTTTTTCTCTTTGCCTGAGAAGTTCATGTTCTTCGATATTCAAGGTCTAGAGTGGTTAAA
AGGCATTCCTCAGCGCAGTACAGTGAAAGTGAAATTCTTCTTTAAGCGCGCATTGCCTTCAGAGGTTGTG
CTTAAAGATAAACACCTCAGGCTGCATTGTACCCCTGCTGTGAACTTATTTGAAAAAGATGGCGATCCAA
TTCGTTTGGAGCATCGTCGCAATGAATACAAAGTACGCCCTCAAAGCAATACTCAAGACCACTATGAAGT
CTACGGAATTGAGCAGGTCGAGAGTTGGAGCAAAGACGAGCGTCGCCGTAAACCATTGATCGAATTCGAA
TCGTTTGAGCACCAAATTAACCAGCGTGATAAGCGAGAGTTCTACAAATCAAAAGTCGGCGAGCGAGTAA
GCGGAAGAGGGTTAGAGCGCTATATTTCGTTCCATACGCATAATGGTGATATTGCGGATTTAGGTACAGA
AACTGTACTGATGAAACTGCAATGTAGCAACGCCGATCTGGCTGAGCGCCTTTCAGTGGGCGACATTACT
TACGCGACCCACAAATCGCCGACGTACGCGACATTTAAAAATATCACCAAGCCGACACAATCGGTGAGCC
CACAGGTGAACGGTGAGCTTCAGTGGCAGCTGATCGCCAATATGTCACTCAACTATTTGTCATTGGCGAA
CATTGATGTGTTGAAAGTGCTGCTCTCGACTTATGACTTCCATTCTCGTGTCGATAGACAAGCTCACCGC
GCGTCGATTCACCGACTCGATGGTATTGTGTCGTCTGAGATGAAACCGATTGACCGCGTGTTCCGTGGCG
TATCTGTACGTGGTAACCAATTTAAGCTGGTGACCAATTCGAAGTTCTTCGTAAATGAAGGCGATATGTT
CCTGATGGCAACCGTACTCAATGAATTCATCCGTTTGTATTCGAGTGTGAACTCCTTTACTGAATTGGAG
GTCTTTGATGAAGCGACAGGTGAAGTGTACAACTGGGCAAGCCTGATTGGACAGCAGACGATTCTATGA