SecReT6
Protein ID: 156977076
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05861
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1049100..1049510 [-]
Producthypothetical protein
NoteTssE
UniProt IDA7N2B2
KEGG IDvha:VIBHAR_05861
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.30E-21, Aligned region: 24..116
Protein Sequence: 136 a.a.     [Download]
>gi|156977076|ref|YP_001447982.1| hypothetical protein VIBHAR_05861 [Vibrio harveyi ATCC BAA-1116]
MEKGYRLLERIELGEPKNCYEKVVSHKHLIESIHSHLADLLNTHSGNAMIDNEYGLPDFNDVLSNNTNLV
RHIQQNITSTIERFEPRLLNVEVHYREDHHNPLQLGFGIRGEVSHNGGKVPMSIDVYMGTDGQFNV
 
Nucleotide Sequence: 411 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1049510-1049100 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGGAAAAAGGTTATCGTCTTTTAGAGCGGATTGAGTTGGGTGAGCCCAAAAATTGCTACGAGAAAGTGG
TGTCTCATAAGCATTTGATCGAATCCATTCATTCTCACCTTGCTGACTTGCTGAATACCCACTCTGGTAA
TGCAATGATCGACAATGAATATGGCCTGCCTGATTTTAACGACGTGCTTTCCAATAACACGAACCTCGTT
CGTCACATTCAACAAAACATCACATCAACCATAGAACGCTTTGAACCGCGACTGCTGAATGTCGAGGTTC
ATTACCGTGAAGACCACCATAACCCATTACAACTCGGCTTTGGTATTCGCGGCGAAGTTTCCCATAACGG
CGGTAAAGTCCCAATGTCGATCGATGTCTACATGGGAACCGACGGCCAATTTAACGTTTAG