SecReT6
Protein ID: 156977078
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05863
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1051056..1051562 [-]
Producthypothetical protein
NoteTssB
UniProt IDA7N4P4
KEGG IDvha:VIBHAR_05863
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.50E-59, Aligned region: 5..158
Protein Sequence: 168 a.a.     [Download]
>gi|156977078|ref|YP_001447984.1| hypothetical protein VIBHAR_05863 [Vibrio harveyi ATCC BAA-1116]
MSRDGSVAPKERINIRYVPATGDTQDDVELPLSMMVVGDFTARADETPIEERTPINIDKDNFNEVLEGMS
PNVKVNVENRLSDEEGGQIGVDLTFQNMKDFSPEAIAKSVPELNSLLELREALVALKGPLGNVPAFRKKI
ASVLQDEEARKKLLDELSIGDDQEAKEE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1051562-1051056 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTCACGTGACGGCTCGGTGGCTCCTAAAGAGCGAATTAATATCCGTTATGTTCCAGCAACTGGTGATA
CGCAAGACGACGTAGAACTGCCGCTGAGCATGATGGTGGTTGGTGACTTTACTGCACGTGCAGATGAGAC
GCCTATCGAAGAACGTACTCCAATCAATATCGACAAAGACAACTTTAACGAAGTGCTAGAAGGCATGTCT
CCAAACGTTAAAGTGAACGTTGAAAACCGCCTTTCTGACGAAGAAGGCGGCCAAATCGGTGTTGATCTAA
CGTTCCAAAACATGAAGGACTTCTCTCCTGAAGCGATCGCGAAAAGCGTACCTGAGCTAAACAGCTTGCT
TGAGCTTCGCGAAGCGTTGGTTGCACTGAAAGGCCCTCTAGGTAACGTTCCTGCGTTCCGTAAGAAGATC
GCATCGGTTCTTCAAGACGAAGAAGCGAGAAAGAAACTGTTGGATGAACTAAGCATTGGCGACGACCAAG
AAGCGAAAGAAGAGTAA