SecReT6
Protein ID: 156977086
SecReT6 ID229
T6SS typei1
Gene symbol-
Locus tagVIBHAR_05871
StrainVibrio harveyi ATCC BAA-1116
Repliconchromosome II [GenBank: NC_009784] [Browse all T6SS(s) in this replicon]
Location [Strand]1061396..1061896 [-]
Producthypothetical protein
NoteTssD
UniProt IDA7N4P1
KEGG IDvha:VIBHAR_05871
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.00E-35, Aligned region: 4..150
Protein Sequence: 166 a.a.     [Download]
>gi|156977086|ref|YP_001447992.1| hypothetical protein VIBHAR_05871 [Vibrio harveyi ATCC BAA-1116]
MSIKGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVVTKVQDR
CSPLLFNALVSGEKLPECVIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVTEEVLKL
TYRAIEVTHENCGTAGNDDWRAPREA
 
Nucleotide Sequence: 501 bp     [Download]
>gi|156975952|ref|NC_009784.1|:c1061896-1061396 Vibrio harveyi ATCC BAA-1116 chromosome II, complete sequence
ATGTCTATCAAAGGTGAAACTCAAGGTCACATCACTAAAGATACTTACTCTGCAGATTCTGTAGGTAACA
CATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTTCAAGAACTAGACCACGTACTAACAGTACCACGTGA
CCCACAAAGTGGTCAGCCTACTGGTCAACGTGTTCACCGTCCACTTGTTGTAACTAAAGTTCAAGACCGT
TGTTCTCCACTACTATTCAACGCACTAGTATCTGGCGAAAAACTTCCTGAGTGTGTGATCCGTTTCTACC
GTACTTCAGTTCAAGGTAAGCAAGAGCACTACTACTCAATCAAACTGATTGATGCACTACTAGTAGACAT
CCAAACTCGCATGAACCACTGTCAAGACGCTGCAACAGCAGACCGCGTGACAGAAGAAGTTCTTAAGCTG
ACTTACCGTGCAATCGAAGTAACTCACGAAAACTGTGGTACAGCTGGTAACGACGACTGGCGTGCTCCAC
GCGAAGCATAA