SecReT6
Protein ID: 157154801
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3123
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3128230..3128730 [+]
Producthypothetical protein
NoteTssB
UniProt IDA7ZQQ9
KEGG IDecw:EcE24377A_3123
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.00E-51, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|157154801|ref|YP_001464138.1| hypothetical protein EcE24377A_3123 [Escherichia coli E24377A]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLSGSGNEQNIALEFKNLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3128230-3128730 Escherichia coli E24377A chromosome, complete genome
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCTGTTGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGTGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGACACACTAAGCGGAAGCGGTAATGAGCAAAATATCGCGCTTG
AATTTAAAAACCTGAAAGATTTTGAACCCGAACAGGTAGCAAAAAATATCCCACAGCTTCGTGTATTACT
CGCTATGCGCAATTTATTACGTGACCTGAAATCCAATCTGCTGGATAACGCAACGTTTCGCCGTGAACTG
GAAAATATTCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA