SecReT6
Protein ID: 157155408
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3129
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3134749..3137394 [+]
ProductClpA/ClpB family protein
NoteTssH
UniProt IDA7ZQR5
KEGG IDecw:EcE24377A_3129
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.50E-41, Aligned region: 238..258
AAA_2 [PF07724], Evalue: 7.50E-41, Aligned region: 609..774
AAA [PF00004], Evalue: 5.60E-20, Aligned region: 22..57
AAA [PF00004], Evalue: 5.60E-20, Aligned region: 240..352
AAA [PF00004], Evalue: 5.60E-20, Aligned region: 614..737
AAA_5 [PF07728], Evalue: 1.80E-14, Aligned region: 240..264
AAA_5 [PF07728], Evalue: 1.80E-14, Aligned region: 613..732
ClpB_D2-small [PF10431], Evalue: 2.70E-14, Aligned region: 780..855
AAA_16 [PF13191], Evalue: 6.30E-14, Aligned region: 217..262
AAA_16 [PF13191], Evalue: 6.30E-14, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 6.30E-14, Aligned region: 487..558
AAA_16 [PF13191], Evalue: 6.30E-14, Aligned region: 596..650
AAA_16 [PF13191], Evalue: 6.30E-14, Aligned region: 678..707
AAA_16 [PF13191], Evalue: 6.30E-14, Aligned region: 753..805
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 239..325
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 483..512
AAA_22 [PF13401], Evalue: 8.90E-09, Aligned region: 610..650
AAA_25 [PF13481], Evalue: 9.90E-09, Aligned region: 240..300
AAA_25 [PF13481], Evalue: 9.90E-09, Aligned region: 609..642
AAA_19 [PF13245], Evalue: 6.90E-08, Aligned region: 237..262
AAA_19 [PF13245], Evalue: 6.90E-08, Aligned region: 609..635
Clp_N [PF02861], Evalue: 4.40E-07, Aligned region: 24..73
Clp_N [PF02861], Evalue: 4.40E-07, Aligned region: 108..124
Arch_ATPase [PF01637], Evalue: 5.20E-07, Aligned region: 218..389
Arch_ATPase [PF01637], Evalue: 5.20E-07, Aligned region: 606..627
Arch_ATPase [PF01637], Evalue: 5.20E-07, Aligned region: 681..695
NACHT [PF05729], Evalue: 1.60E-06, Aligned region: 113..134
NACHT [PF05729], Evalue: 1.60E-06, Aligned region: 240..332
NACHT [PF05729], Evalue: 1.60E-06, Aligned region: 613..637
IstB_IS21 [PF01695], Evalue: 1.80E-06, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 1.80E-06, Aligned region: 498..531
IstB_IS21 [PF01695], Evalue: 1.80E-06, Aligned region: 613..632
AAA_17 [PF13207], Evalue: 2.00E-06, Aligned region: 240..342
AAA_17 [PF13207], Evalue: 2.00E-06, Aligned region: 612..648
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 240..337
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 611..695
Zeta_toxin [PF06414], Evalue: 5.70E-06, Aligned region: 233..270
Zeta_toxin [PF06414], Evalue: 5.70E-06, Aligned region: 604..653
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 224..254
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 612..730
Sigma54_activat [PF00158], Evalue: 1.30E-05, Aligned region: 763..797
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 240..278
AAA_18 [PF13238], Evalue: 0.00022, Aligned region: 614..639
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0012, Aligned region: 609..624
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 241..262
RNA_helicase [PF00910], Evalue: 0.002, Aligned region: 614..635
AAA_24 [PF13479], Evalue: 0.0021, Aligned region: 240..255
AAA_24 [PF13479], Evalue: 0.0021, Aligned region: 614..635
T2SE [PF00437], Evalue: 0.0038, Aligned region: 224..259
T2SE [PF00437], Evalue: 0.0038, Aligned region: 609..690
DUF2075 [PF09848], Evalue: 0.0047, Aligned region: 242..342
DUF2075 [PF09848], Evalue: 0.0047, Aligned region: 501..532
DUF2075 [PF09848], Evalue: 0.0047, Aligned region: 612..635
AAA_10 [PF12846], Evalue: 0.0069, Aligned region: 239..264
AAA_10 [PF12846], Evalue: 0.0069, Aligned region: 306..328
AAA_10 [PF12846], Evalue: 0.0069, Aligned region: 613..646
ResIII [PF04851], Evalue: 0.0078, Aligned region: 189..262
ResIII [PF04851], Evalue: 0.0078, Aligned region: 308..322
ResIII [PF04851], Evalue: 0.0078, Aligned region: 613..635
Protein Sequence: 881 a.a.     [Download]
>gi|157155408|ref|YP_001464144.1| ClpA/ClpB family protein [Escherichia coli E24377A]
MTGNHPAALLRRLNPYCARALDAAASLCQTRAHAEITIEHWLLKLLEQGEGDITVIARRYEWDIDTLWQS
LLAHLDTLPRSVRERPQLSEPLTALIRQAWLIASLEGDDPQIRSQHLLMALTEKPMLPACNDLWVLLSLS
RVQFERLRPLLDAQSDECPARQPQVTEPLTSAQPGVATTDAPANTLTGKQDDALLAVLNRFTEDVTEKAR
SGRIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVHIRTLDLG
LLQAGAGVKGEFEQRLKNVIDAVQKSPEPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAA
TTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKARYAQHHGVHMLDSAIQTAVRLSRRYLTG
RQLPDKAVDLLDTAGARVRMSLDTLPEPLTQLHARLAALDIEREAIEQDSVFYPEASPERLAELIDLRDE
LQAEAGHLETQYQQEKRLAQQIMTLRQEGTDSTELQQQLRTHQGFAPLLALDVDARAVATVVADWTGIPL
SSLLRDEQSDLLSMEQSLENRVVGQSPALCAIAQRLRAAKTGLTPENGPQGVFLLTGPSGTGKTETALTL
ADTLFGGEKSLITINLSEYQEPHTVSQLKGAPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVEKAHRDVMN
LFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLEEKPDATDADLHELLYPLLREHFQPALMA
RFQTVIYRPLGQEAMRAIVEMKLAQVVRRLRQHYGLETEINDSLYDALTAACLLPDTGARNIDSLLNQQI
LPVLSQQLLAQQAAHRKPAQLRLGWDEEDGIVLEFATEEMQ
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3134749-3137394 Escherichia coli E24377A chromosome, complete genome
ATGACCGGAAATCACCCCGCCGCGCTGCTGCGTCGCCTTAACCCATACTGTGCACGGGCGCTGGACGCTG
CCGCCTCACTGTGTCAGACCCGCGCCCATGCGGAGATAACCATTGAACACTGGCTGCTGAAACTGCTGGA
GCAGGGAGAAGGCGATATCACGGTGATTGCCCGCCGCTATGAATGGGATATCGACACGCTCTGGCAGTCT
CTGCTGGCACATCTGGACACCTTACCCCGCTCGGTCCGCGAACGTCCGCAGCTTTCTGAACCCCTGACGG
CGCTTATCAGACAGGCGTGGCTGATTGCTTCGCTGGAAGGCGACGACCCGCAAATCCGCAGCCAGCACCT
GCTGATGGCGCTGACAGAAAAACCGATGCTGCCCGCCTGTAATGACCTGTGGGTATTGCTGAGCCTGAGC
CGTGTGCAGTTTGAGCGGCTGCGTCCCCTGCTGGATGCGCAGTCGGATGAATGCCCGGCACGTCAGCCAC
AGGTCACCGAACCGCTGACATCCGCGCAACCCGGGGTGGCAACGACGGACGCACCGGCAAACACGCTGAC
GGGGAAACAGGATGACGCCCTGCTGGCGGTACTTAACCGCTTTACCGAAGACGTGACGGAAAAAGCCCGC
AGCGGGCGCATCGACCCGGTATTCGGGCGCGACACCGAAATTCGCCAGATGGTGGATATCCTCTCCCGTC
GCCGCAAAAACAACCCGATTCTGGTGGGAGAACCGGGGGTGGGCAAAACCGCACTGGTGGAAGGGCTGGC
GCTGCGTATCGCCGAAGGCAATGTACCGGACAGCCTGAAAACGGTGCATATCCGCACGCTGGACCTCGGT
CTGTTACAGGCTGGCGCGGGCGTTAAAGGCGAATTTGAGCAGCGGCTGAAAAACGTGATTGATGCAGTAC
AGAAATCACCGGAGCCGGTACTACTGTTTATTGATGAAGCCCATACCATTATCGGCGCGGGTAATCAGGC
GGGCGGCGCGGATGCGGCGAACCTGCTGAAACCGGCGCTGGCAAGGGGCGAACTGCGCACCATCGCGGCG
ACCACATGGAGCGAATACAAACAGTATTTTGAGCGCGACGCCGCGCTGGAACGCCGCTTCCAGATGGTGA
AAGTCGACGAGCCGGATGACGATACCGCCTGCCTGATGCTGCGGGGACTCAAGGCCCGCTATGCACAGCA
CCACGGCGTGCATATGCTGGACAGCGCCATTCAGACCGCCGTGCGCCTGTCGCGCCGCTATCTGACCGGG
CGCCAGTTGCCGGACAAGGCGGTTGATTTGCTGGATACCGCCGGGGCAAGAGTCCGCATGAGCCTTGACA
CCCTGCCGGAACCGTTGACGCAGCTTCATGCGCGACTGGCGGCACTGGATATTGAGCGGGAAGCGATTGA
GCAGGACAGCGTATTTTATCCCGAAGCCAGCCCGGAGCGGCTGGCGGAACTGATCGATTTGCGTGATGAG
TTACAGGCAGAAGCCGGGCATCTGGAAACGCAGTATCAGCAGGAAAAGCGGCTTGCGCAGCAGATTATGA
CGTTGCGTCAGGAAGGGACAGACAGCACTGAACTGCAACAGCAACTGCGAACACATCAGGGCTTTGCACC
GCTGCTGGCGCTGGATGTGGACGCCCGCGCCGTCGCCACGGTGGTGGCGGACTGGACCGGCATCCCGCTC
TCTTCCCTGCTCAGGGACGAACAGAGCGACCTGCTCAGTATGGAACAAAGCCTTGAAAACCGCGTTGTCG
GACAAAGCCCGGCGCTCTGCGCCATCGCACAGCGGCTGCGGGCGGCTAAAACCGGCCTCACGCCGGAGAA
TGGCCCACAGGGGGTATTCCTGCTGACCGGCCCCAGCGGCACCGGTAAAACCGAAACTGCGCTCACACTG
GCCGACACCCTGTTTGGCGGTGAAAAATCCCTTATCACCATCAACCTCTCCGAATATCAGGAGCCGCATA
CCGTCTCCCAGCTTAAGGGGGCTCCTCCGGGCTACGTTGGCTACGGTCAGGGCGGCGTACTCACCGAAGC
CGTTCGCAAACGCCCGTACAGCGTGGTGCTGCTCGACGAAGTGGAAAAGGCGCATCGCGACGTGATGAAC
CTGTTCTATCAGGTATTTGATCGGGGCTTTATGCGCGACGGCGAAGGCCGGGAAATTGACTTCCGCAACA
CCGTGATTCTGATGACGGCTAATCTGGGCAGTGACCACATCATGCAGCTGCTGGAGGAAAAACCGGACGC
CACGGACGCAGACCTGCATGAACTGCTGTACCCCCTGCTGCGCGAGCACTTCCAGCCTGCACTGATGGCG
CGTTTTCAGACGGTGATTTACCGCCCTCTGGGACAGGAAGCGATGCGCGCCATTGTGGAAATGAAACTGG
CGCAGGTGGTTCGTCGTCTTCGTCAGCACTATGGGCTGGAAACGGAAATCAACGACAGCCTGTATGACGC
GCTGACCGCCGCCTGCCTGCTGCCGGACACCGGGGCGCGTAATATCGACAGCCTGCTGAACCAGCAAATC
CTGCCGGTCTTAAGCCAGCAGTTGCTGGCGCAACAGGCCGCGCACCGTAAACCAGCCCAGCTACGGCTTG
GCTGGGATGAGGAAGACGGGATTGTACTGGAGTTCGCTACGGAAGAGATGCAATAA