SecReT6
Protein ID: 157155635
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0226
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]241926..242408 [-]
Producthypothetical protein
NoteTssD
UniProt IDA7ZHV6
KEGG IDecw:EcE24377A_0226
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-31, Aligned region: 6..145
Protein Sequence: 160 a.a.     [Download]
>gi|157155635|ref|YP_001461385.1| hypothetical protein EcE24377A_0226 [Escherichia coli E24377A]
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELIITKPVDKSSP
LLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDI
SWEHTLAGTNAMSKWQDRVQ
 
Nucleotide Sequence: 483 bp     [Download]
>gi|157154711|ref|NC_009801.1|:c242408-241926 Escherichia coli E24377A chromosome, complete genome
ATGGCAAATATAAGTTATTTATCTTTGAGTGGAGAGACACAAGGGCTAATTTCAGCAGGTTGCTCAACGC
TTGATTCTGTCGGAAACAAAGCGCAGCCAGAACATAAAGATCAGATCATGGTTTATGCGTTAATGCATTC
CATCTCAAGAAGTCAAAATGTCAATCATCATGAATTAATTATCACCAAACCGGTTGATAAATCCTCACCA
TTGCTGGCAAAAGCACTTAGTGACAATGAAAAAATGGCAATATGTGAATTTATACTCTACCGAACCAGTA
AAGCGGGTATTTACCAGCCTTATTATAAAATAAATCTGTCAAAAGCCCGAATATCAAGTATTGATTTTGT
CACACCGCATGCTGTCCTGGAAAAAGAACTGGAACCACAGGAGAGAATTGCCTTTATTTATGAAGATATT
TCCTGGGAGCATACGTTAGCCGGTACGAATGCAATGAGTAAATGGCAGGATCGTGTACAGTAA

Protein ID: 157157744
SecReT6 ID231
T6SS typei1
Gene symbol-
Locus tagEcE24377A_0243
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]262492..263010 [+]
Producthypothetical protein
NoteTssD
UniProt IDA7ZHX3
KEGG IDecw:EcE24377A_0243
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-34, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0061, Aligned region: 95..136
Protein Sequence: 172 a.a.     [Download]
>gi|157157744|ref|YP_001461402.1| hypothetical protein EcE24377A_0243 [Escherichia coli E24377A]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPAGQRAHKPFIF
TVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTIVDMKLHMPHCQDPAKREFTQ
LLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|157154711|ref|NC_009801.1|:262492-263010 Escherichia coli E24377A chromosome, complete genome
ATGCCAACACCGTGTTATATCTCCATCACTGGTCAGACCCAGGGAAATATTACTGCAGGTGCATTTACCG
CTGATTCTGTCGGCAACATCTATGTGCAGGGGCACGAAGACGAGATGCTGGTGCAGGAATTCCTGCATAA
CGTTACTGTCCCGACCGATCCTCAGTCCGGTCAGCCTGCGGGTCAGCGTGCTCACAAGCCTTTCATTTTT
ACCGTGGCGCTGAACAAAGCGGTTCCGCTGATGTACAACGCACTGGCCTCCGGCGAAATGCTGCCAACCA
CTGAACTTCACTGGTGGCGTACCTCTGTGGAGGGCAAACAGGAGCATTATTTCACTACCCGCCTGACTGA
TTCGACGATTGTCGATATGAAACTGCATATGCCGCATTGCCAGGACCCGGCGAAACGCGAGTTCACCCAG
TTGCTCGAAGTTTCACTGGCCTACCGCAAAATTGAATGGGAACACGTCAAATCTGGCACCTCCGGTGCCG
ACGACTGGCGCGCACCGCTGGAAGCATAA