SecReT6
Protein ID: 157155664
SecReT6 ID232
T6SS typei2
Gene symbol-
Locus tagEcE24377A_3125
StrainEscherichia coli E24377A
Repliconchromosome [GenBank: NC_009801] [Browse all T6SS(s) in this replicon]
Location [Strand]3130345..3131682 [+]
Producthypothetical protein
NoteTssK
UniProt IDA7ZQR1
KEGG IDecw:EcE24377A_3125
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-132, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|157155664|ref|YP_001464140.1| hypothetical protein EcE24377A_3125 [Escherichia coli E24377A]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALMSGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLHALTNDSAVVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQGYITCPLARLVRDVQGNWTQDEGYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLESLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVPLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|157154711|ref|NC_009801.1|:3130345-3131682 Escherichia coli E24377A chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAACTTTGTATTCGTCATCCGTGGGGGATCGCGAATGT
GCTCTTTGACCGCGATGCCCTGATGTCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCTGACGTGAGCGATGTTCTGCCTCTCGCCTGCGATCTGCACGCGCTGACGAACG
ACAGCGCGGTTGTTCTGCTGGCGCTGCCGCTTGCCCATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTACGCTATCGTCAGGAATGGCAAAAGGTACAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGGTTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGGGCTATATTCCGCCGTT
ACTGGCGTTTAATGCTCATGACGGGTTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGTCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGTTGCTTAACGCGCTGAACTCCGCCGAGCCGGTGCTGAGTGATTTCCTGCGCTACCCGGC
GGTTCATCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGAGCGCTGCTGACGTTTTCCCTTGAA
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCACTGTCTTTCCGCCACTGTTCTCCC
TGCTTAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCGCTGGATCTGGAATCCCTGCCGGG
CAACCGCTGGAAAGCCGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGATTTTTACCTGTCCGTTCGT
TCCTCACTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAACGTGGCGCTGAATGGTGTTCCACTGGTGCCACTGACCTCAGTTCCGGCAGCGCT
GCCACTGCGCCTGGAGAATCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCAGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA